Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | EB817_RS03705 | Genome accession | NZ_CP033336 |
| Coordinates | 686707..686889 (+) | Length | 60 a.a. |
| NCBI ID | WP_063632461.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain TSPY165 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 655732..686889 | 686707..686889 | within | 0 |
Gene organization within MGE regions
Location: 655732..686889
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EB817_RS03480 (EB817_03485) | - | 655750..656592 (+) | 843 | WP_032460551.1 | SGNH/GDSL hydrolase family protein | - |
| EB817_RS03485 (EB817_03490) | - | 656570..657157 (+) | 588 | WP_002989129.1 | YpmS family protein | - |
| EB817_RS03490 (EB817_03495) | - | 657256..657531 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| EB817_RS03495 (EB817_03500) | - | 657620..658762 (-) | 1143 | WP_003051793.1 | site-specific integrase | - |
| EB817_RS03500 (EB817_03505) | - | 658886..659404 (-) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| EB817_RS03505 (EB817_03510) | - | 659416..660171 (-) | 756 | WP_010922480.1 | XRE family transcriptional regulator | - |
| EB817_RS03510 (EB817_03515) | - | 660373..660585 (+) | 213 | WP_010922479.1 | helix-turn-helix transcriptional regulator | - |
| EB817_RS03515 (EB817_03520) | - | 660855..661166 (+) | 312 | WP_010922478.1 | excisionase | - |
| EB817_RS03520 (EB817_03525) | - | 661168..661353 (+) | 186 | WP_023079923.1 | hypothetical protein | - |
| EB817_RS09440 (EB817_03530) | - | 661447..661716 (+) | 270 | WP_011106700.1 | replication protein | - |
| EB817_RS03530 (EB817_03535) | - | 661857..662243 (+) | 387 | WP_063632588.1 | DnaD domain-containing protein | - |
| EB817_RS03535 (EB817_03540) | - | 662224..662457 (+) | 234 | WP_002985387.1 | hypothetical protein | - |
| EB817_RS03540 (EB817_03545) | - | 662454..662594 (+) | 141 | WP_011017992.1 | hypothetical protein | - |
| EB817_RS03545 (EB817_03550) | - | 662603..662815 (+) | 213 | WP_063632587.1 | hypothetical protein | - |
| EB817_RS03550 (EB817_03555) | bet | 662836..663681 (+) | 846 | WP_063632586.1 | phage recombination protein Bet | - |
| EB817_RS03555 (EB817_03560) | - | 663691..664719 (+) | 1029 | WP_063632585.1 | DUF1351 domain-containing protein | - |
| EB817_RS03560 (EB817_03565) | - | 664915..665256 (+) | 342 | WP_011888757.1 | hypothetical protein | - |
| EB817_RS03565 (EB817_03570) | - | 665253..665765 (+) | 513 | WP_129304588.1 | hypothetical protein | - |
| EB817_RS09445 (EB817_03575) | - | 665752..665937 (+) | 186 | WP_011017985.1 | hypothetical protein | - |
| EB817_RS03575 (EB817_03580) | - | 665942..666211 (+) | 270 | WP_063632583.1 | hypothetical protein | - |
| EB817_RS03580 (EB817_03585) | - | 666215..666442 (+) | 228 | WP_063632582.1 | hypothetical protein | - |
| EB817_RS03585 (EB817_03590) | - | 666430..666912 (+) | 483 | WP_063632581.1 | class I SAM-dependent methyltransferase | - |
| EB817_RS03595 (EB817_03600) | - | 667090..667509 (+) | 420 | WP_003051720.1 | DUF1492 domain-containing protein | - |
| EB817_RS03600 (EB817_03605) | - | 667616..667954 (+) | 339 | WP_129304590.1 | HNH endonuclease signature motif containing protein | - |
| EB817_RS03605 (EB817_03610) | - | 668110..668466 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| EB817_RS03610 (EB817_03615) | - | 668463..669731 (+) | 1269 | WP_129304591.1 | phage portal protein | - |
| EB817_RS03615 (EB817_03620) | - | 669724..671217 (+) | 1494 | WP_011017978.1 | hypothetical protein | - |
| EB817_RS03620 (EB817_03625) | - | 671223..671447 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| EB817_RS03625 (EB817_03630) | - | 671497..671676 (+) | 180 | WP_002994098.1 | hypothetical protein | - |
| EB817_RS03630 (EB817_03635) | - | 671669..671938 (+) | 270 | WP_002994096.1 | hypothetical protein | - |
| EB817_RS03635 (EB817_03640) | - | 672002..673417 (+) | 1416 | WP_063632577.1 | hypothetical protein | - |
| EB817_RS03640 (EB817_03645) | - | 673602..675410 (+) | 1809 | WP_063632570.1 | hypothetical protein | - |
| EB817_RS03645 (EB817_03650) | - | 675407..676102 (+) | 696 | WP_011888770.1 | hypothetical protein | - |
| EB817_RS03650 (EB817_03655) | - | 676084..678060 (+) | 1977 | WP_164976421.1 | phage tail spike protein | - |
| EB817_RS03655 (EB817_03660) | hylP | 678057..679073 (+) | 1017 | WP_129304595.1 | hyaluronidase HylP | - |
| EB817_RS03660 (EB817_03665) | - | 679088..680872 (+) | 1785 | WP_011888773.1 | gp58-like family protein | - |
| EB817_RS03665 (EB817_03670) | - | 680884..681312 (+) | 429 | WP_129304597.1 | DUF1617 family protein | - |
| EB817_RS03670 (EB817_03675) | - | 681315..681947 (+) | 633 | WP_111690665.1 | hypothetical protein | - |
| EB817_RS03675 (EB817_03680) | - | 681957..682412 (+) | 456 | WP_002988455.1 | phage holin family protein | - |
| EB817_RS09575 | - | 682414..682536 (+) | 123 | WP_002988460.1 | hypothetical protein | - |
| EB817_RS03680 (EB817_03685) | - | 682524..683732 (+) | 1209 | WP_063632462.1 | glucosaminidase domain-containing protein | - |
| EB817_RS03685 (EB817_03690) | spem | 684597..685310 (+) | 714 | WP_011017838.1 | streptococcal pyrogenic exotoxin SpeM | - |
| EB817_RS03695 (EB817_03700) | - | 685786..686361 (+) | 576 | WP_011054727.1 | hypothetical protein | - |
| EB817_RS09450 (EB817_03705) | - | 686355..686642 (+) | 288 | WP_011106694.1 | hypothetical protein | - |
| EB817_RS03705 (EB817_03710) | prx | 686707..686889 (+) | 183 | WP_063632461.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7081.04 Da Isoelectric Point: 4.1079
>NTDB_id=323075 EB817_RS03705 WP_063632461.1 686707..686889(+) (prx) [Streptococcus pyogenes strain TSPY165]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=323075 EB817_RS03705 WP_063632461.1 686707..686889(+) (prx) [Streptococcus pyogenes strain TSPY165]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGCAAGAA
TGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGCAAGAA
TGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
91.667 |
100 |
0.917 |
| prx | Streptococcus pyogenes MGAS8232 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
70 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |