Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | EB818_RS07650 | Genome accession | NZ_CP033335 |
| Coordinates | 1501426..1501605 (-) | Length | 59 a.a. |
| NCBI ID | WP_038432505.1 | Uniprot ID | A0A8B6IX98 |
| Organism | Streptococcus pyogenes strain TSPY208 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1500317..1515929 | 1501426..1501605 | within | 0 |
Gene organization within MGE regions
Location: 1500317..1515929
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EB818_RS07640 (EB818_07650) | - | 1500317..1500538 (-) | 222 | WP_002988211.1 | helix-turn-helix transcriptional regulator | - |
| EB818_RS07645 (EB818_07655) | - | 1500707..1501081 (+) | 375 | WP_002988207.1 | helix-turn-helix transcriptional regulator | - |
| EB818_RS07650 (EB818_07660) | prx | 1501426..1501605 (-) | 180 | WP_038432505.1 | hypothetical protein | Regulator |
| EB818_RS07655 (EB818_07665) | sda3 | 1501844..1502644 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| EB818_RS07665 (EB818_07675) | - | 1503400..1504266 (-) | 867 | WP_011888701.1 | DUF334 domain-containing protein | - |
| EB818_RS07670 (EB818_07680) | - | 1504254..1504778 (-) | 525 | WP_012560947.1 | type II toxin-antitoxin system antitoxin SocA domain-containing protein | - |
| EB818_RS07675 (EB818_07685) | - | 1504918..1506126 (-) | 1209 | WP_012560948.1 | glucosaminidase domain-containing protein | - |
| EB818_RS07680 (EB818_07690) | - | 1506242..1506427 (-) | 186 | WP_129322762.1 | phage holin | - |
| EB818_RS07685 (EB818_07695) | - | 1506445..1506969 (-) | 525 | Protein_1422 | DUF1366 domain-containing protein | - |
| EB818_RS07690 (EB818_07700) | - | 1506972..1508951 (-) | 1980 | WP_129322763.1 | gp58-like family protein | - |
| EB818_RS07695 (EB818_07705) | - | 1508967..1509971 (-) | 1005 | WP_012560951.1 | hyaluronoglucosaminidase | - |
| EB818_RS07700 (EB818_07710) | - | 1509968..1510726 (-) | 759 | Protein_1425 | hypothetical protein | - |
| EB818_RS07705 (EB818_07715) | - | 1510727..1511185 (+) | 459 | Protein_1426 | ABC transporter permease | - |
| EB818_RS07710 (EB818_07720) | - | 1511182..1511463 (+) | 282 | Protein_1427 | ATP-binding cassette domain-containing protein | - |
| EB818_RS07715 (EB818_07725) | - | 1511670..1512200 (+) | 531 | WP_161237452.1 | DUF536 domain-containing protein | - |
| EB818_RS07720 (EB818_07730) | - | 1512249..1512836 (+) | 588 | WP_011018202.1 | 3'-5' exonuclease | - |
| EB818_RS07725 (EB818_07735) | - | 1512989..1513726 (+) | 738 | WP_002982961.1 | MerR family transcriptional regulator | - |
| EB818_RS07730 (EB818_07740) | - | 1513783..1514082 (-) | 300 | WP_002988205.1 | YbaB/EbfC family nucleoid-associated protein | - |
| EB818_RS07740 (EB818_07750) | - | 1514214..1515929 (-) | 1716 | Protein_1432 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6792.86 Da Isoelectric Point: 4.0650
>NTDB_id=323037 EB818_RS07650 WP_038432505.1 1501426..1501605(-) (prx) [Streptococcus pyogenes strain TSPY208]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPGEPVRPWEVMTVEVAGEVLMELR
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPGEPVRPWEVMTVEVAGEVLMELR
Nucleotide
Download Length: 180 bp
>NTDB_id=323037 EB818_RS07650 WP_038432505.1 1501426..1501605(-) (prx) [Streptococcus pyogenes strain TSPY208]
ATGCTAACATACGACGAGTTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCCGGTGAGCCTGTGAGACCGTGGGAGGTTATGACAGTTGAAGTAGCGGGAGAAG
TGCTAATGGAATTGAGGTGA
ATGCTAACATACGACGAGTTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCCGGTGAGCCTGTGAGACCGTGGGAGGTTATGACAGTTGAAGTAGCGGGAGAAG
TGCTAATGGAATTGAGGTGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
75.862 |
98.305 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
75.862 |
98.305 |
0.746 |
| prx | Streptococcus pyogenes MGAS8232 |
74.138 |
98.305 |
0.729 |
| prx | Streptococcus pyogenes MGAS315 |
74.138 |
98.305 |
0.729 |
| prx | Streptococcus pyogenes MGAS315 |
90.476 |
71.186 |
0.644 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
69.492 |
0.593 |
| prx | Streptococcus pyogenes MGAS315 |
75.61 |
69.492 |
0.525 |