Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | EB818_RS05080 | Genome accession | NZ_CP033335 |
| Coordinates | 981204..981392 (-) | Length | 62 a.a. |
| NCBI ID | WP_011054546.1 | Uniprot ID | A0A5S4TJS4 |
| Organism | Streptococcus pyogenes strain TSPY208 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 973617..993069 | 981204..981392 | within | 0 |
Gene organization within MGE regions
Location: 973617..993069
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EB818_RS05045 (EB818_05055) | pfkA | 973617..974630 (-) | 1014 | WP_002984444.1 | 6-phosphofructokinase | - |
| EB818_RS05050 (EB818_05060) | - | 974710..977820 (-) | 3111 | WP_031488246.1 | DNA polymerase III subunit alpha | - |
| EB818_RS05055 (EB818_05065) | - | 978004..978375 (+) | 372 | WP_002989617.1 | GntR family transcriptional regulator | - |
| EB818_RS05060 (EB818_05070) | - | 978375..979073 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| EB818_RS05065 (EB818_05075) | - | 979083..979868 (+) | 786 | WP_129322706.1 | ABC transporter permease | - |
| EB818_RS05070 (EB818_05080) | - | 979999..980613 (-) | 615 | WP_129322707.1 | TVP38/TMEM64 family protein | - |
| EB818_RS05080 (EB818_05090) | prx | 981204..981392 (-) | 189 | WP_011054546.1 | hypothetical protein | Regulator |
| EB818_RS05085 (EB818_05095) | spel | 981507..982295 (-) | 789 | WP_021340779.1 | streptococcal pyrogenic exotoxin SpeL | - |
| EB818_RS05090 (EB818_05100) | spem | 982577..983257 (-) | 681 | WP_129322708.1 | streptococcal pyrogenic exotoxin SpeM | - |
| EB818_RS05095 (EB818_05105) | - | 983226..983750 (-) | 525 | WP_129322709.1 | type II toxin-antitoxin system antitoxin SocA domain-containing protein | - |
| EB818_RS05100 (EB818_05110) | - | 983889..985097 (-) | 1209 | WP_012560948.1 | glucosaminidase domain-containing protein | - |
| EB818_RS05105 (EB818_05115) | - | 985145..985918 (-) | 774 | Protein_928 | terminase large subunit | - |
| EB818_RS05110 (EB818_05120) | - | 985933..986400 (-) | 468 | WP_002985371.1 | phage terminase small subunit P27 family | - |
| EB818_RS05115 (EB818_05125) | - | 986569..986910 (-) | 342 | WP_029714359.1 | HNH endonuclease signature motif containing protein | - |
| EB818_RS05125 (EB818_05135) | - | 987146..987331 (+) | 186 | WP_001132273.1 | type II toxin-antitoxin system HicA family toxin | - |
| EB818_RS05130 (EB818_05140) | - | 987383..987760 (+) | 378 | WP_002987543.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| EB818_RS09150 | - | 988055..988288 (+) | 234 | WP_002995461.1 | hypothetical protein | - |
| EB818_RS05140 (EB818_05150) | - | 988378..989292 (-) | 915 | WP_011284864.1 | hypothetical protein | - |
| EB818_RS05150 (EB818_05160) | - | 990064..990504 (-) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| EB818_RS05155 (EB818_05165) | - | 990777..991412 (-) | 636 | WP_021340848.1 | N-6 DNA methylase | - |
| EB818_RS05160 (EB818_05170) | - | 991526..992086 (+) | 561 | Protein_937 | site-specific integrase | - |
| EB818_RS05165 (EB818_05175) | - | 992449..993069 (+) | 621 | WP_129322710.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7226.17 Da Isoelectric Point: 3.9947
>NTDB_id=323024 EB818_RS05080 WP_011054546.1 981204..981392(-) (prx) [Streptococcus pyogenes strain TSPY208]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=323024 EB818_RS05080 WP_011054546.1 981204..981392(-) (prx) [Streptococcus pyogenes strain TSPY208]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
95.161 |
0.806 |
| prx | Streptococcus pyogenes MGAS8232 |
84.483 |
93.548 |
0.79 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
77.966 |
95.161 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
66.129 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |