Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | D8S76_RS06765 | Genome accession | NZ_CP032699 |
| Coordinates | 1331453..1331635 (-) | Length | 60 a.a. |
| NCBI ID | WP_011018104.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain TSPY155 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1331453..1371717 | 1331453..1331635 | within | 0 |
Gene organization within MGE regions
Location: 1331453..1371717
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D8S76_RS06765 (D8S76_06765) | prx | 1331453..1331635 (-) | 183 | WP_011018104.1 | hypothetical protein | Regulator |
| D8S76_RS06770 (D8S76_06770) | mf2 | 1331908..1332666 (+) | 759 | WP_011184727.1 | DNase Mf2 | - |
| D8S76_RS06775 (D8S76_06775) | speC | 1332777..1333484 (+) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| D8S76_RS06780 (D8S76_06780) | - | 1334096..1335305 (-) | 1210 | Protein_1265 | glucosaminidase domain-containing protein | - |
| D8S76_RS06785 (D8S76_06785) | - | 1335417..1335872 (-) | 456 | WP_002988455.1 | phage holin family protein | - |
| D8S76_RS06790 (D8S76_06790) | - | 1335888..1336514 (-) | 627 | WP_115224617.1 | hypothetical protein | - |
| D8S76_RS06795 (D8S76_06795) | - | 1336517..1336945 (-) | 429 | WP_115224618.1 | DUF1617 family protein | - |
| D8S76_RS06800 (D8S76_06800) | - | 1336957..1338843 (-) | 1887 | WP_115224619.1 | gp58-like family protein | - |
| D8S76_RS06805 (D8S76_06805) | hylP | 1338856..1339878 (-) | 1023 | WP_020837648.1 | hyaluronidase HylP | - |
| D8S76_RS06810 (D8S76_06810) | - | 1339875..1342019 (-) | 2145 | WP_115224620.1 | phage tail spike protein | - |
| D8S76_RS06815 (D8S76_06815) | - | 1342016..1342732 (-) | 717 | WP_115224621.1 | distal tail protein Dit | - |
| D8S76_RS06820 (D8S76_06820) | - | 1342729..1345989 (-) | 3261 | WP_115224622.1 | tape measure protein | - |
| D8S76_RS06825 (D8S76_06825) | - | 1345979..1346560 (-) | 582 | WP_010922087.1 | bacteriophage Gp15 family protein | - |
| D8S76_RS06830 (D8S76_06830) | - | 1346564..1346998 (-) | 435 | WP_010922086.1 | hypothetical protein | - |
| D8S76_RS06835 (D8S76_06835) | - | 1347037..1347522 (-) | 486 | WP_011054741.1 | phage tail tube protein | - |
| D8S76_RS06840 (D8S76_06840) | - | 1347522..1347920 (-) | 399 | WP_010922084.1 | minor capsid protein | - |
| D8S76_RS06845 (D8S76_06845) | - | 1347917..1348273 (-) | 357 | WP_010922083.1 | minor capsid protein | - |
| D8S76_RS06850 (D8S76_06850) | - | 1348273..1348605 (-) | 333 | WP_010922082.1 | minor capsid protein | - |
| D8S76_RS06855 (D8S76_06855) | - | 1348595..1349011 (-) | 417 | WP_010922081.1 | hypothetical protein | - |
| D8S76_RS06860 (D8S76_06860) | - | 1349065..1349883 (-) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| D8S76_RS06865 (D8S76_06865) | - | 1349887..1350501 (-) | 615 | WP_115224623.1 | hypothetical protein | - |
| D8S76_RS06870 (D8S76_06870) | - | 1350627..1350893 (-) | 267 | WP_010922078.1 | hypothetical protein | - |
| D8S76_RS06875 (D8S76_06875) | - | 1350980..1351207 (-) | 228 | WP_010922077.1 | hypothetical protein | - |
| D8S76_RS06880 (D8S76_06880) | - | 1351207..1352700 (-) | 1494 | WP_010922076.1 | phage minor capsid protein | - |
| D8S76_RS06885 (D8S76_06885) | - | 1352705..1354207 (-) | 1503 | WP_010922075.1 | phage portal protein | - |
| D8S76_RS06890 (D8S76_06890) | - | 1354221..1355512 (-) | 1292 | Protein_1287 | PBSX family phage terminase large subunit | - |
| D8S76_RS06895 (D8S76_06895) | - | 1355515..1355991 (-) | 477 | WP_010922073.1 | hypothetical protein | - |
| D8S76_RS06900 (D8S76_06900) | - | 1356334..1357500 (-) | 1167 | WP_115224624.1 | DNA modification methylase | - |
| D8S76_RS06905 (D8S76_06905) | - | 1357834..1358271 (-) | 438 | WP_003052405.1 | DUF1492 domain-containing protein | - |
| D8S76_RS06920 (D8S76_06915) | - | 1358727..1358942 (-) | 216 | WP_032463293.1 | hypothetical protein | - |
| D8S76_RS06925 (D8S76_06920) | - | 1359111..1359875 (-) | 765 | WP_021299463.1 | site-specific DNA-methyltransferase | - |
| D8S76_RS06930 (D8S76_06925) | - | 1359865..1360134 (-) | 270 | WP_115224625.1 | hypothetical protein | - |
| D8S76_RS09785 (D8S76_06930) | - | 1360139..1360324 (-) | 186 | WP_011017985.1 | hypothetical protein | - |
| D8S76_RS06940 (D8S76_06935) | - | 1360311..1360823 (-) | 513 | WP_115224626.1 | hypothetical protein | - |
| D8S76_RS06945 (D8S76_06940) | - | 1360820..1361161 (-) | 342 | WP_161737273.1 | hypothetical protein | - |
| D8S76_RS09610 | - | 1361242..1361409 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| D8S76_RS06950 (D8S76_06945) | - | 1361419..1362216 (-) | 798 | WP_115224628.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| D8S76_RS06955 (D8S76_06950) | - | 1362213..1363178 (-) | 966 | WP_115224629.1 | recombinase RecT | - |
| D8S76_RS06960 (D8S76_06955) | - | 1363181..1363510 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| D8S76_RS06965 (D8S76_06960) | - | 1363532..1363786 (-) | 255 | WP_063629029.1 | hypothetical protein | - |
| D8S76_RS06970 (D8S76_06965) | - | 1363773..1364120 (-) | 348 | WP_012560971.1 | hypothetical protein | - |
| D8S76_RS06975 (D8S76_06970) | - | 1364261..1365043 (-) | 783 | WP_111705650.1 | ATP-binding protein | - |
| D8S76_RS06980 (D8S76_06975) | - | 1365030..1365791 (-) | 762 | WP_014635613.1 | DnaD domain protein | - |
| D8S76_RS06985 (D8S76_06980) | - | 1365885..1366022 (-) | 138 | WP_011017881.1 | hypothetical protein | - |
| D8S76_RS06990 (D8S76_06985) | - | 1366053..1366304 (-) | 252 | WP_011888682.1 | AlpA family transcriptional regulator | - |
| D8S76_RS06995 (D8S76_06990) | - | 1366375..1366560 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| D8S76_RS07000 (D8S76_06995) | - | 1366727..1366966 (+) | 240 | WP_115224630.1 | hypothetical protein | - |
| D8S76_RS07005 (D8S76_07000) | - | 1367064..1367783 (-) | 720 | WP_011888681.1 | phage antirepressor KilAC domain-containing protein | - |
| D8S76_RS07010 (D8S76_07005) | - | 1367811..1368023 (-) | 213 | WP_014635614.1 | DNA-binding protein | - |
| D8S76_RS07015 (D8S76_07010) | - | 1368221..1368562 (+) | 342 | WP_011888679.1 | helix-turn-helix transcriptional regulator | - |
| D8S76_RS07020 (D8S76_07015) | - | 1368546..1368932 (+) | 387 | WP_023605207.1 | ImmA/IrrE family metallo-endopeptidase | - |
| D8S76_RS07025 (D8S76_07020) | - | 1368947..1370368 (+) | 1422 | WP_014635616.1 | DUF4041 domain-containing protein | - |
| D8S76_RS07030 (D8S76_07025) | - | 1370551..1371717 (+) | 1167 | WP_011018152.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6935.81 Da Isoelectric Point: 3.9417
>NTDB_id=318277 D8S76_RS06765 WP_011018104.1 1331453..1331635(-) (prx) [Streptococcus pyogenes strain TSPY155]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPHEEARNGEVVTEEVVEEVMVELDK
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPHEEARNGEVVTEEVVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=318277 D8S76_RS06765 WP_011018104.1 1331453..1331635(-) (prx) [Streptococcus pyogenes strain TSPY155]
ATGCTAACATACGACGAATTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGCGAGAAATGGAGAAGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAATTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGCGAGAAATGGAGAAGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
93.023 |
71.667 |
0.667 |