Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS28085_RS04370 | Genome accession | NZ_CP032666 |
| Coordinates | 847097..847285 (+) | Length | 62 a.a. |
| NCBI ID | WP_002993136.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS28085 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 800345..849402 | 847097..847285 | within | 0 |
Gene organization within MGE regions
Location: 800345..849402
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS28085_RS04025 (MGAS28085_04025) | - | 800345..800965 (-) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
| MGAS28085_RS04030 (MGAS28085_04030) | - | 801328..802416 (-) | 1089 | WP_023079773.1 | site-specific integrase | - |
| MGAS28085_RS04035 (MGAS28085_04035) | - | 802666..803475 (-) | 810 | WP_002984270.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| MGAS28085_RS04040 (MGAS28085_04040) | - | 803488..804231 (-) | 744 | WP_011284884.1 | XRE family transcriptional regulator | - |
| MGAS28085_RS09400 | - | 804589..804738 (+) | 150 | WP_021340643.1 | hypothetical protein | - |
| MGAS28085_RS04045 (MGAS28085_04045) | - | 804724..804939 (-) | 216 | WP_021341080.1 | hypothetical protein | - |
| MGAS28085_RS04050 (MGAS28085_04050) | - | 804998..805156 (+) | 159 | WP_011284883.1 | hypothetical protein | - |
| MGAS28085_RS04055 (MGAS28085_04055) | - | 805186..805785 (-) | 600 | WP_011284882.1 | hypothetical protein | - |
| MGAS28085_RS04060 (MGAS28085_04060) | - | 805839..806048 (+) | 210 | WP_011284881.1 | hypothetical protein | - |
| MGAS28085_RS04065 (MGAS28085_04065) | - | 806037..806423 (-) | 387 | WP_011054589.1 | hypothetical protein | - |
| MGAS28085_RS04070 (MGAS28085_04070) | - | 806497..806724 (+) | 228 | WP_002984281.1 | hypothetical protein | - |
| MGAS28085_RS04075 (MGAS28085_04075) | - | 806832..807341 (-) | 510 | WP_011017884.1 | hypothetical protein | - |
| MGAS28085_RS04085 (MGAS28085_04085) | - | 807600..807809 (-) | 210 | WP_002984292.1 | hypothetical protein | - |
| MGAS28085_RS04090 (MGAS28085_04090) | - | 807959..808198 (-) | 240 | WP_011284879.1 | hypothetical protein | - |
| MGAS28085_RS04095 (MGAS28085_04095) | - | 808365..808550 (+) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| MGAS28085_RS04100 (MGAS28085_04100) | - | 808629..808925 (+) | 297 | WP_011017882.1 | MerR family transcriptional regulator | - |
| MGAS28085_RS04105 (MGAS28085_04105) | - | 808922..809059 (+) | 138 | WP_011017881.1 | hypothetical protein | - |
| MGAS28085_RS04110 (MGAS28085_04110) | - | 809140..809469 (+) | 330 | WP_011284878.1 | hypothetical protein | - |
| MGAS28085_RS04115 (MGAS28085_04115) | - | 809469..809663 (+) | 195 | WP_002984315.1 | hypothetical protein | - |
| MGAS28085_RS04120 (MGAS28085_04120) | - | 809660..809944 (+) | 285 | WP_011284877.1 | hypothetical protein | - |
| MGAS28085_RS04125 (MGAS28085_04125) | - | 809941..810624 (+) | 684 | WP_002984321.1 | AAA family ATPase | - |
| MGAS28085_RS04130 (MGAS28085_04130) | - | 810639..812063 (+) | 1425 | Protein_744 | DEAD/DEAH box helicase | - |
| MGAS28085_RS04135 (MGAS28085_04135) | - | 812068..812550 (+) | 483 | WP_002984328.1 | DUF669 domain-containing protein | - |
| MGAS28085_RS04140 (MGAS28085_04140) | - | 812568..814119 (+) | 1552 | Protein_746 | phage resistance protein | - |
| MGAS28085_RS04145 (MGAS28085_04145) | - | 814388..815257 (+) | 870 | WP_014635521.1 | bifunctional DNA primase/polymerase | - |
| MGAS28085_RS04150 (MGAS28085_04150) | - | 815277..815561 (+) | 285 | WP_011284874.1 | VRR-NUC domain-containing protein | - |
| MGAS28085_RS04155 (MGAS28085_04155) | - | 815545..815901 (+) | 357 | WP_011284873.1 | hypothetical protein | - |
| MGAS28085_RS09655 (MGAS28085_04160) | - | 815898..816143 (+) | 246 | WP_011284872.1 | hypothetical protein | - |
| MGAS28085_RS04165 (MGAS28085_04165) | - | 816143..816379 (+) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| MGAS28085_RS09405 | - | 816376..816546 (+) | 171 | WP_002995952.1 | hypothetical protein | - |
| MGAS28085_RS04170 (MGAS28085_04170) | - | 816543..816827 (+) | 285 | WP_011284869.1 | hypothetical protein | - |
| MGAS28085_RS04175 (MGAS28085_04175) | - | 816829..817461 (+) | 633 | WP_011888685.1 | N-6 DNA methylase | - |
| MGAS28085_RS04180 (MGAS28085_04180) | - | 817466..817945 (+) | 480 | WP_011888686.1 | DUF1642 domain-containing protein | - |
| MGAS28085_RS04185 (MGAS28085_04185) | - | 818394..818828 (+) | 435 | WP_011284866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| MGAS28085_RS04195 (MGAS28085_04195) | - | 819406..820320 (+) | 915 | WP_011284864.1 | hypothetical protein | - |
| MGAS28085_RS09410 | - | 820410..820643 (-) | 234 | WP_002995461.1 | hypothetical protein | - |
| MGAS28085_RS04205 (MGAS28085_04205) | - | 820938..821315 (-) | 378 | WP_002987543.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| MGAS28085_RS04210 (MGAS28085_04210) | - | 821367..821552 (-) | 186 | WP_001132273.1 | type II toxin-antitoxin system HicA family toxin | - |
| MGAS28085_RS04215 (MGAS28085_04215) | - | 821651..822082 (+) | 432 | WP_023079766.1 | terminase small subunit | - |
| MGAS28085_RS04220 (MGAS28085_04220) | - | 822060..823367 (+) | 1308 | WP_020833530.1 | PBSX family phage terminase large subunit | - |
| MGAS28085_RS04225 (MGAS28085_04225) | - | 823379..824881 (+) | 1503 | WP_002984369.1 | phage portal protein | - |
| MGAS28085_RS04230 (MGAS28085_04230) | - | 824862..826424 (+) | 1563 | WP_011284860.1 | phage head morphogenesis protein | - |
| MGAS28085_RS04235 (MGAS28085_04235) | - | 826428..826613 (+) | 186 | WP_002988389.1 | hypothetical protein | - |
| MGAS28085_RS04240 (MGAS28085_04240) | - | 826683..826997 (+) | 315 | WP_011284859.1 | hypothetical protein | - |
| MGAS28085_RS04245 (MGAS28085_04245) | - | 827000..827266 (+) | 267 | WP_011284858.1 | hypothetical protein | - |
| MGAS28085_RS04250 (MGAS28085_04250) | - | 827410..827943 (+) | 534 | WP_023079765.1 | DUF4355 domain-containing protein | - |
| MGAS28085_RS04255 (MGAS28085_04255) | - | 827953..828333 (+) | 381 | WP_011284856.1 | head decoration protein | - |
| MGAS28085_RS04260 (MGAS28085_04260) | - | 828336..829418 (+) | 1083 | WP_011284855.1 | major capsid protein | - |
| MGAS28085_RS04265 (MGAS28085_04265) | - | 829428..829670 (+) | 243 | WP_011284854.1 | HeH/LEM domain-containing protein | - |
| MGAS28085_RS04270 (MGAS28085_04270) | - | 829684..830037 (+) | 354 | WP_002984392.1 | phage head-tail connector protein | - |
| MGAS28085_RS04275 (MGAS28085_04275) | - | 830034..830342 (+) | 309 | WP_011284852.1 | hypothetical protein | - |
| MGAS28085_RS04280 (MGAS28085_04280) | - | 830323..830688 (+) | 366 | WP_030126607.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MGAS28085_RS04285 (MGAS28085_04285) | - | 830685..831074 (+) | 390 | WP_011284850.1 | hypothetical protein | - |
| MGAS28085_RS04290 (MGAS28085_04290) | - | 831129..831752 (+) | 624 | WP_030126608.1 | phage major tail protein, TP901-1 family | - |
| MGAS28085_RS04295 (MGAS28085_04295) | - | 831806..832159 (+) | 354 | WP_002990023.1 | tail assembly chaperone | - |
| MGAS28085_RS04300 (MGAS28085_04300) | - | 832234..832530 (+) | 297 | WP_021340179.1 | hypothetical protein | - |
| MGAS28085_RS04305 (MGAS28085_04305) | - | 832545..836180 (+) | 3636 | WP_011284846.1 | tape measure protein | - |
| MGAS28085_RS04310 (MGAS28085_04310) | - | 836212..836991 (+) | 780 | WP_011284845.1 | distal tail protein Dit | - |
| MGAS28085_RS04315 (MGAS28085_04315) | - | 836988..839042 (+) | 2055 | WP_011284844.1 | phage tail spike protein | - |
| MGAS28085_RS04320 (MGAS28085_04320) | - | 839039..840253 (+) | 1215 | WP_011284843.1 | hypothetical protein | - |
| MGAS28085_RS04325 (MGAS28085_04325) | - | 840255..840569 (+) | 315 | WP_021340983.1 | hypothetical protein | - |
| MGAS28085_RS04330 (MGAS28085_04330) | - | 840580..842475 (+) | 1896 | WP_011284841.1 | gp58-like family protein | - |
| MGAS28085_RS04335 (MGAS28085_04335) | - | 842489..842650 (+) | 162 | WP_002988795.1 | hypothetical protein | - |
| MGAS28085_RS04340 (MGAS28085_04340) | - | 842653..843270 (+) | 618 | WP_011284840.1 | hypothetical protein | - |
| MGAS28085_RS04345 (MGAS28085_04345) | - | 843281..843577 (+) | 297 | WP_002990012.1 | hypothetical protein | - |
| MGAS28085_RS04350 (MGAS28085_04350) | - | 843574..843759 (+) | 186 | WP_011284839.1 | holin | - |
| MGAS28085_RS04355 (MGAS28085_04355) | - | 843871..845205 (+) | 1335 | WP_011284838.1 | GH25 family lysozyme | - |
| MGAS28085_RS04360 (MGAS28085_04360) | speC | 845281..845988 (-) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| MGAS28085_RS04365 (MGAS28085_04365) | mf2 | 846099..846857 (-) | 759 | WP_011184727.1 | DNase Mf2 | - |
| MGAS28085_RS04370 (MGAS28085_04370) | prx | 847097..847285 (+) | 189 | WP_002993136.1 | hypothetical protein | Regulator |
| MGAS28085_RS04380 (MGAS28085_04380) | - | 847876..848490 (+) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| MGAS28085_RS04385 (MGAS28085_04385) | - | 848617..849402 (-) | 786 | WP_002984433.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7239.28 Da Isoelectric Point: 3.9944
>NTDB_id=317810 MGAS28085_RS04370 WP_002993136.1 847097..847285(+) (prx) [Streptococcus pyogenes strain MGAS28085]
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=317810 MGAS28085_RS04370 WP_002993136.1 847097..847285(+) (prx) [Streptococcus pyogenes strain MGAS28085]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85.484 |
100 |
0.855 |
| prx | Streptococcus pyogenes MGAS8232 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
79.31 |
93.548 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
95.238 |
67.742 |
0.645 |
| prx | Streptococcus pyogenes MGAS315 |
80.488 |
66.129 |
0.532 |