Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS27961_RS04370 | Genome accession | NZ_CP032665 |
| Coordinates | 848000..848188 (+) | Length | 62 a.a. |
| NCBI ID | WP_002993136.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS27961 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 801251..850305 | 848000..848188 | within | 0 |
Gene organization within MGE regions
Location: 801251..850305
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS27961_RS04025 (MGAS27961_04025) | - | 801251..801871 (-) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
| MGAS27961_RS04030 (MGAS27961_04030) | - | 802234..803322 (-) | 1089 | WP_023079773.1 | site-specific integrase | - |
| MGAS27961_RS04035 (MGAS27961_04035) | - | 803572..804381 (-) | 810 | WP_002984270.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| MGAS27961_RS04040 (MGAS27961_04040) | - | 804394..805137 (-) | 744 | WP_011284884.1 | XRE family transcriptional regulator | - |
| MGAS27961_RS09435 | - | 805495..805644 (+) | 150 | WP_021340643.1 | hypothetical protein | - |
| MGAS27961_RS04045 (MGAS27961_04045) | - | 805630..805845 (-) | 216 | WP_021341080.1 | hypothetical protein | - |
| MGAS27961_RS04050 (MGAS27961_04050) | - | 805904..806062 (+) | 159 | WP_011284883.1 | hypothetical protein | - |
| MGAS27961_RS04055 (MGAS27961_04055) | - | 806092..806691 (-) | 600 | WP_011284882.1 | hypothetical protein | - |
| MGAS27961_RS04060 (MGAS27961_04060) | - | 806745..806954 (+) | 210 | WP_011284881.1 | hypothetical protein | - |
| MGAS27961_RS04065 (MGAS27961_04065) | - | 806943..807329 (-) | 387 | WP_011054589.1 | hypothetical protein | - |
| MGAS27961_RS04070 (MGAS27961_04070) | - | 807403..807630 (+) | 228 | WP_002984281.1 | hypothetical protein | - |
| MGAS27961_RS04075 (MGAS27961_04075) | - | 807738..808247 (-) | 510 | WP_011017884.1 | hypothetical protein | - |
| MGAS27961_RS04085 (MGAS27961_04085) | - | 808506..808715 (-) | 210 | WP_002984292.1 | hypothetical protein | - |
| MGAS27961_RS04090 (MGAS27961_04090) | - | 808865..809104 (-) | 240 | WP_011284879.1 | hypothetical protein | - |
| MGAS27961_RS04095 (MGAS27961_04095) | - | 809271..809456 (+) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| MGAS27961_RS04100 (MGAS27961_04100) | - | 809535..809831 (+) | 297 | WP_011017882.1 | MerR family transcriptional regulator | - |
| MGAS27961_RS04105 (MGAS27961_04105) | - | 809828..809965 (+) | 138 | WP_011017881.1 | hypothetical protein | - |
| MGAS27961_RS04110 (MGAS27961_04110) | - | 810046..810375 (+) | 330 | WP_011284878.1 | hypothetical protein | - |
| MGAS27961_RS04115 (MGAS27961_04115) | - | 810375..810569 (+) | 195 | WP_002984315.1 | hypothetical protein | - |
| MGAS27961_RS04120 (MGAS27961_04120) | - | 810566..810850 (+) | 285 | WP_011284877.1 | hypothetical protein | - |
| MGAS27961_RS04125 (MGAS27961_04125) | - | 810847..811530 (+) | 684 | WP_002984321.1 | AAA family ATPase | - |
| MGAS27961_RS04130 (MGAS27961_04130) | - | 811545..812969 (+) | 1425 | Protein_744 | DEAD/DEAH box helicase | - |
| MGAS27961_RS04135 (MGAS27961_04135) | - | 812974..813456 (+) | 483 | WP_002984328.1 | DUF669 domain-containing protein | - |
| MGAS27961_RS04140 (MGAS27961_04140) | - | 813474..815027 (+) | 1554 | WP_011284875.1 | hypothetical protein | - |
| MGAS27961_RS04145 (MGAS27961_04145) | - | 815291..816160 (+) | 870 | WP_014635521.1 | bifunctional DNA primase/polymerase | - |
| MGAS27961_RS04150 (MGAS27961_04150) | - | 816180..816464 (+) | 285 | WP_011284874.1 | VRR-NUC domain-containing protein | - |
| MGAS27961_RS04155 (MGAS27961_04155) | - | 816448..816804 (+) | 357 | WP_011284873.1 | hypothetical protein | - |
| MGAS27961_RS09705 (MGAS27961_04160) | - | 816801..817046 (+) | 246 | WP_011284872.1 | hypothetical protein | - |
| MGAS27961_RS04165 (MGAS27961_04165) | - | 817046..817282 (+) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| MGAS27961_RS09440 | - | 817279..817449 (+) | 171 | WP_002995952.1 | hypothetical protein | - |
| MGAS27961_RS04170 (MGAS27961_04170) | - | 817446..817730 (+) | 285 | WP_011284869.1 | hypothetical protein | - |
| MGAS27961_RS04175 (MGAS27961_04175) | - | 817732..818364 (+) | 633 | WP_011888685.1 | N-6 DNA methylase | - |
| MGAS27961_RS04180 (MGAS27961_04180) | - | 818369..818848 (+) | 480 | WP_011888686.1 | DUF1642 domain-containing protein | - |
| MGAS27961_RS04185 (MGAS27961_04185) | - | 819297..819731 (+) | 435 | WP_011284866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| MGAS27961_RS04195 (MGAS27961_04195) | - | 820309..821223 (+) | 915 | WP_011284864.1 | hypothetical protein | - |
| MGAS27961_RS09445 | - | 821313..821546 (-) | 234 | WP_002995461.1 | hypothetical protein | - |
| MGAS27961_RS04205 (MGAS27961_04205) | - | 821841..822218 (-) | 378 | WP_002987543.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| MGAS27961_RS04210 (MGAS27961_04210) | - | 822270..822455 (-) | 186 | WP_001132273.1 | type II toxin-antitoxin system HicA family toxin | - |
| MGAS27961_RS04215 (MGAS27961_04215) | - | 822554..822985 (+) | 432 | WP_023079766.1 | terminase small subunit | - |
| MGAS27961_RS04220 (MGAS27961_04220) | - | 822963..824270 (+) | 1308 | WP_020833530.1 | PBSX family phage terminase large subunit | - |
| MGAS27961_RS04225 (MGAS27961_04225) | - | 824282..825784 (+) | 1503 | WP_002984369.1 | phage portal protein | - |
| MGAS27961_RS04230 (MGAS27961_04230) | - | 825765..827327 (+) | 1563 | WP_011284860.1 | phage head morphogenesis protein | - |
| MGAS27961_RS04235 (MGAS27961_04235) | - | 827331..827516 (+) | 186 | WP_002988389.1 | hypothetical protein | - |
| MGAS27961_RS04240 (MGAS27961_04240) | - | 827586..827900 (+) | 315 | WP_011284859.1 | hypothetical protein | - |
| MGAS27961_RS04245 (MGAS27961_04245) | - | 827903..828169 (+) | 267 | WP_011284858.1 | hypothetical protein | - |
| MGAS27961_RS04250 (MGAS27961_04250) | - | 828313..828846 (+) | 534 | WP_023079765.1 | DUF4355 domain-containing protein | - |
| MGAS27961_RS04255 (MGAS27961_04255) | - | 828856..829236 (+) | 381 | WP_011284856.1 | head decoration protein | - |
| MGAS27961_RS04260 (MGAS27961_04260) | - | 829239..830321 (+) | 1083 | WP_011284855.1 | major capsid protein | - |
| MGAS27961_RS04265 (MGAS27961_04265) | - | 830331..830573 (+) | 243 | WP_011284854.1 | HeH/LEM domain-containing protein | - |
| MGAS27961_RS04270 (MGAS27961_04270) | - | 830587..830940 (+) | 354 | WP_002984392.1 | phage head-tail connector protein | - |
| MGAS27961_RS04275 (MGAS27961_04275) | - | 830937..831245 (+) | 309 | WP_011284852.1 | hypothetical protein | - |
| MGAS27961_RS04280 (MGAS27961_04280) | - | 831226..831591 (+) | 366 | WP_030126607.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MGAS27961_RS04285 (MGAS27961_04285) | - | 831588..831977 (+) | 390 | WP_011284850.1 | hypothetical protein | - |
| MGAS27961_RS04290 (MGAS27961_04290) | - | 832032..832655 (+) | 624 | WP_030126608.1 | phage major tail protein, TP901-1 family | - |
| MGAS27961_RS04295 (MGAS27961_04295) | - | 832709..833062 (+) | 354 | WP_002990023.1 | tail assembly chaperone | - |
| MGAS27961_RS04300 (MGAS27961_04300) | - | 833137..833433 (+) | 297 | WP_021340179.1 | hypothetical protein | - |
| MGAS27961_RS04305 (MGAS27961_04305) | - | 833448..837083 (+) | 3636 | WP_011284846.1 | tape measure protein | - |
| MGAS27961_RS04310 (MGAS27961_04310) | - | 837115..837894 (+) | 780 | WP_011284845.1 | distal tail protein Dit | - |
| MGAS27961_RS04315 (MGAS27961_04315) | - | 837891..839945 (+) | 2055 | WP_011284844.1 | phage tail spike protein | - |
| MGAS27961_RS04320 (MGAS27961_04320) | - | 839942..841156 (+) | 1215 | WP_011284843.1 | hypothetical protein | - |
| MGAS27961_RS04325 (MGAS27961_04325) | - | 841158..841472 (+) | 315 | WP_021340983.1 | hypothetical protein | - |
| MGAS27961_RS04330 (MGAS27961_04330) | - | 841483..843378 (+) | 1896 | WP_011284841.1 | gp58-like family protein | - |
| MGAS27961_RS04335 (MGAS27961_04335) | - | 843392..843553 (+) | 162 | WP_002988795.1 | hypothetical protein | - |
| MGAS27961_RS04340 (MGAS27961_04340) | - | 843556..844173 (+) | 618 | WP_011284840.1 | hypothetical protein | - |
| MGAS27961_RS04345 (MGAS27961_04345) | - | 844184..844480 (+) | 297 | WP_002990012.1 | hypothetical protein | - |
| MGAS27961_RS04350 (MGAS27961_04350) | - | 844477..844662 (+) | 186 | WP_011284839.1 | holin | - |
| MGAS27961_RS04355 (MGAS27961_04355) | - | 844774..846108 (+) | 1335 | WP_011284838.1 | GH25 family lysozyme | - |
| MGAS27961_RS04360 (MGAS27961_04360) | speC | 846184..846891 (-) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| MGAS27961_RS04365 (MGAS27961_04365) | mf2 | 847002..847760 (-) | 759 | WP_011184727.1 | DNase Mf2 | - |
| MGAS27961_RS04370 (MGAS27961_04370) | prx | 848000..848188 (+) | 189 | WP_002993136.1 | hypothetical protein | Regulator |
| MGAS27961_RS04380 (MGAS27961_04380) | - | 848779..849393 (+) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| MGAS27961_RS04385 (MGAS27961_04385) | - | 849520..850305 (-) | 786 | WP_002984433.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7239.28 Da Isoelectric Point: 3.9944
>NTDB_id=317756 MGAS27961_RS04370 WP_002993136.1 848000..848188(+) (prx) [Streptococcus pyogenes strain MGAS27961]
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=317756 MGAS27961_RS04370 WP_002993136.1 848000..848188(+) (prx) [Streptococcus pyogenes strain MGAS27961]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85.484 |
100 |
0.855 |
| prx | Streptococcus pyogenes MGAS8232 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
79.31 |
93.548 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
95.238 |
67.742 |
0.645 |
| prx | Streptococcus pyogenes MGAS315 |
80.488 |
66.129 |
0.532 |