Detailed information
Overview
| Name | clpP | Type | Regulator |
| Locus tag | D6022_RS00250 | Genome accession | NZ_CP032538 |
| Coordinates | 23811..24407 (+) | Length | 198 a.a. |
| NCBI ID | WP_003185550.1 | Uniprot ID | A0A1J6GJE1 |
| Organism | Bacillus licheniformis strain MT-B06 | ||
| Function | degradation of ComK; degradation of DegU (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 153..24407 | 23811..24407 | within | 0 |
Gene organization within MGE regions
Location: 153..24407
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D6022_RS00010 | - | 153..536 (-) | 384 | WP_020450356.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| D6022_RS00015 | - | 536..862 (-) | 327 | WP_017474687.1 | phage head closure protein | - |
| D6022_RS00020 | - | 852..1145 (-) | 294 | WP_017474688.1 | head-tail connector protein | - |
| D6022_RS00025 | - | 1203..1637 (-) | 435 | WP_020450355.1 | collagen-like protein | - |
| D6022_RS00030 | - | 1661..2863 (-) | 1203 | WP_120155418.1 | phage major capsid protein | - |
| D6022_RS00035 | - | 2912..3508 (-) | 597 | WP_073412029.1 | HK97 family phage prohead protease | - |
| D6022_RS00040 | - | 3501..4742 (-) | 1242 | WP_073412030.1 | phage portal protein | - |
| D6022_RS00045 | - | 4747..4950 (-) | 204 | WP_017474257.1 | hypothetical protein | - |
| D6022_RS00050 | - | 4971..6677 (-) | 1707 | WP_120155421.1 | terminase large subunit | - |
| D6022_RS00055 | - | 6670..7164 (-) | 495 | WP_017474594.1 | phage terminase small subunit P27 family | - |
| D6022_RS00060 | - | 7398..7661 (-) | 264 | WP_017474631.1 | Gp49 family protein | - |
| D6022_RS00070 | - | 8041..8298 (-) | 258 | WP_017474629.1 | hypothetical protein | - |
| D6022_RS00075 | - | 8301..9008 (-) | 708 | WP_120155426.1 | hypothetical protein | - |
| D6022_RS00080 | - | 8996..9241 (-) | 246 | WP_120155430.1 | hypothetical protein | - |
| D6022_RS00085 | - | 9244..9465 (-) | 222 | WP_048407332.1 | hypothetical protein | - |
| D6022_RS24710 | - | 9820..10164 (-) | 345 | WP_120155437.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| D6022_RS00095 | - | 10166..10369 (-) | 204 | WP_017474601.1 | hypothetical protein | - |
| D6022_RS00100 | - | 10706..11248 (-) | 543 | WP_017474600.1 | site-specific integrase | - |
| D6022_RS00105 | - | 11248..11688 (-) | 441 | WP_017474599.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| D6022_RS24440 | - | 11703..11831 (-) | 129 | WP_017474598.1 | hypothetical protein | - |
| D6022_RS00110 | - | 11986..12234 (-) | 249 | WP_017474597.1 | hypothetical protein | - |
| D6022_RS00115 | - | 12234..12413 (-) | 180 | WP_120155440.1 | hypothetical protein | - |
| D6022_RS00120 | - | 12410..12601 (-) | 192 | WP_026080838.1 | hypothetical protein | - |
| D6022_RS00125 | - | 12598..12996 (-) | 399 | WP_120155445.1 | YopX family protein | - |
| D6022_RS00130 | - | 12993..13460 (-) | 468 | WP_120155450.1 | YopX family protein | - |
| D6022_RS00145 | - | 13971..14204 (-) | 234 | WP_017474645.1 | hypothetical protein | - |
| D6022_RS00150 | - | 14240..14440 (-) | 201 | WP_017474644.1 | XtrA/YqaO family protein | - |
| D6022_RS00155 | - | 14512..14661 (-) | 150 | WP_017475012.1 | BH0509 family protein | - |
| D6022_RS00160 | - | 14766..15323 (-) | 558 | WP_225852969.1 | hypothetical protein | - |
| D6022_RS24715 | - | 15311..15469 (-) | 159 | WP_017475014.1 | DUF6906 family protein | - |
| D6022_RS23755 | - | 15466..15624 (-) | 159 | WP_017475015.1 | hypothetical protein | - |
| D6022_RS00165 | - | 15638..16471 (-) | 834 | WP_120155736.1 | ATP-binding protein | - |
| D6022_RS00170 | - | 16455..17312 (-) | 858 | WP_120155455.1 | conserved phage C-terminal domain-containing protein | - |
| D6022_RS00175 | - | 17305..17535 (-) | 231 | WP_026080815.1 | hypothetical protein | - |
| D6022_RS00180 | - | 17589..17855 (+) | 267 | WP_017474557.1 | hypothetical protein | - |
| D6022_RS00185 | - | 17852..18088 (-) | 237 | WP_073461319.1 | hypothetical protein | - |
| D6022_RS00190 | - | 18090..18335 (-) | 246 | WP_017474860.1 | hypothetical protein | - |
| D6022_RS23760 | - | 18382..18543 (-) | 162 | WP_161517572.1 | hypothetical protein | - |
| D6022_RS00195 | - | 18598..18810 (+) | 213 | WP_009330098.1 | hypothetical protein | - |
| D6022_RS00200 | - | 18807..19010 (-) | 204 | WP_017475041.1 | hypothetical protein | - |
| D6022_RS00205 | - | 19118..19516 (-) | 399 | WP_120155459.1 | hypothetical protein | - |
| D6022_RS00210 | - | 19529..20233 (-) | 705 | WP_120155462.1 | Rha family transcriptional regulator | - |
| D6022_RS00215 | - | 20252..20572 (-) | 321 | WP_017473907.1 | DUF771 domain-containing protein | - |
| D6022_RS00220 | - | 20584..20826 (-) | 243 | WP_017473906.1 | helix-turn-helix transcriptional regulator | - |
| D6022_RS00225 | - | 21002..21334 (+) | 333 | WP_017473905.1 | helix-turn-helix domain-containing protein | - |
| D6022_RS00230 | - | 21338..21790 (+) | 453 | WP_017473904.1 | ImmA/IrrE family metallo-endopeptidase | - |
| D6022_RS00235 | - | 21807..22919 (+) | 1113 | WP_017473903.1 | tyrosine-type recombinase/integrase | - |
| D6022_RS00245 | - | 23253..23570 (-) | 318 | WP_009329632.1 | TM2 domain-containing protein | - |
| D6022_RS00250 | clpP | 23811..24407 (+) | 597 | WP_003185550.1 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | Regulator |
Sequence
Protein
Download Length: 198 a.a. Molecular weight: 21803.99 Da Isoelectric Point: 4.7982
>NTDB_id=316803 D6022_RS00250 WP_003185550.1 23811..24407(+) (clpP) [Bacillus licheniformis strain MT-B06]
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLEAEDPEKDISIYINSPGGSITAGMAIYDT
MQFIKPQVSTICTGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILSLRDKLNKILAERTGQ
PLEVIERDTDRDNFKTAEEAKEYGLIDKVLTRNIDAQK
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLEAEDPEKDISIYINSPGGSITAGMAIYDT
MQFIKPQVSTICTGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILSLRDKLNKILAERTGQ
PLEVIERDTDRDNFKTAEEAKEYGLIDKVLTRNIDAQK
Nucleotide
Download Length: 597 bp
>NTDB_id=316803 D6022_RS00250 WP_003185550.1 23811..24407(+) (clpP) [Bacillus licheniformis strain MT-B06]
ATGAATTTAATACCTACAGTCATTGAACAGACGAACCGCGGGGAAAGAGCGTATGACATTTACTCACGCTTGTTGAAAGA
CCGTATCATTATGCTGGGATCAGCAATCGATGACAATGTTGCGAACTCCATCGTATCTCAGCTTCTATTCCTTGAAGCCG
AAGATCCAGAAAAAGATATCAGCATCTATATCAACAGCCCTGGCGGCTCCATCACAGCCGGTATGGCGATTTATGACACC
ATGCAGTTTATTAAACCGCAAGTCTCCACGATTTGTACGGGAATGGCGGCATCCATGGGTGCGTTCCTTCTTGCAGCCGG
CGAGAAAGGGAAGCGCTACGCTCTTCCAAACAGTGAAGTCATGATCCACCAGCCGCTTGGCGGAGCGCAGGGTCAGGCGA
CTGAAATTGAAATTGCCGCGAAACGCATTCTTTCATTGCGCGACAAGCTGAACAAAATCCTTGCAGAGCGCACTGGGCAG
CCGCTTGAAGTAATCGAGCGCGATACAGACCGCGACAACTTCAAAACGGCTGAAGAAGCAAAAGAATACGGCCTGATTGA
TAAAGTGCTTACACGCAATATCGACGCACAGAAGTAA
ATGAATTTAATACCTACAGTCATTGAACAGACGAACCGCGGGGAAAGAGCGTATGACATTTACTCACGCTTGTTGAAAGA
CCGTATCATTATGCTGGGATCAGCAATCGATGACAATGTTGCGAACTCCATCGTATCTCAGCTTCTATTCCTTGAAGCCG
AAGATCCAGAAAAAGATATCAGCATCTATATCAACAGCCCTGGCGGCTCCATCACAGCCGGTATGGCGATTTATGACACC
ATGCAGTTTATTAAACCGCAAGTCTCCACGATTTGTACGGGAATGGCGGCATCCATGGGTGCGTTCCTTCTTGCAGCCGG
CGAGAAAGGGAAGCGCTACGCTCTTCCAAACAGTGAAGTCATGATCCACCAGCCGCTTGGCGGAGCGCAGGGTCAGGCGA
CTGAAATTGAAATTGCCGCGAAACGCATTCTTTCATTGCGCGACAAGCTGAACAAAATCCTTGCAGAGCGCACTGGGCAG
CCGCTTGAAGTAATCGAGCGCGATACAGACCGCGACAACTTCAAAACGGCTGAAGAAGCAAAAGAATACGGCCTGATTGA
TAAAGTGCTTACACGCAATATCGACGCACAGAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| clpP | Bacillus subtilis subsp. subtilis str. 168 |
92.386 |
99.495 |
0.919 |
| clpP | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
68.229 |
96.97 |
0.662 |
| clpP | Streptococcus thermophilus LMG 18311 |
58.031 |
97.475 |
0.566 |
| clpP | Streptococcus thermophilus LMD-9 |
58.031 |
97.475 |
0.566 |
| clpP | Lactococcus lactis subsp. cremoris KW2 |
56.995 |
97.475 |
0.556 |
| clpP | Streptococcus pneumoniae Rx1 |
56.995 |
97.475 |
0.556 |
| clpP | Streptococcus pneumoniae D39 |
56.995 |
97.475 |
0.556 |
| clpP | Streptococcus pneumoniae R6 |
56.995 |
97.475 |
0.556 |
| clpP | Streptococcus pneumoniae TIGR4 |
56.995 |
97.475 |
0.556 |
| clpP | Streptococcus pyogenes JRS4 |
55.44 |
97.475 |
0.54 |
| clpP | Streptococcus pyogenes MGAS315 |
55.44 |
97.475 |
0.54 |
| clpP | Streptococcus mutans UA159 |
54.639 |
97.98 |
0.535 |
| clpP | Lactococcus lactis subsp. lactis strain DGCC12653 |
54.922 |
97.475 |
0.535 |