Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   LL1196_RS12105 Genome accession   NZ_CP032148
Coordinates   2312711..2313010 (-) Length   99 a.a.
NCBI ID   WP_011677181.1    Uniprot ID   A0AA47KWG7
Organism   Lactococcus cremoris strain 1196     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2307711..2318010
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LL1196_RS12085 (LL1196_2422) - 2309637..2310446 (-) 810 WP_011677177.1 metal ABC transporter permease -
  LL1196_RS12090 (LL1196_2423) - 2310439..2311176 (-) 738 WP_011677178.1 metal ABC transporter ATP-binding protein -
  LL1196_RS12095 (LL1196_2424) - 2311355..2312197 (-) 843 WP_021216263.1 metal ABC transporter solute-binding protein, Zn/Mn family -
  LL1196_RS12100 (LL1196_2425) - 2312194..2312631 (-) 438 WP_011677180.1 zinc-dependent MarR family transcriptional regulator -
  LL1196_RS12105 (LL1196_03775) comGG 2312711..2313010 (-) 300 WP_011677181.1 competence type IV pilus minor pilin ComGG Machinery gene
  LL1196_RS12110 (LL1196_2426) comGF 2313034..2313459 (-) 426 WP_021216262.1 competence type IV pilus minor pilin ComGF Machinery gene
  LL1196_RS12115 (LL1196_2427) comGE 2313443..2313739 (-) 297 WP_021164977.1 competence type IV pilus minor pilin ComGE Machinery gene
  LL1196_RS12120 (LL1196_03780) comGD 2313711..2313899 (-) 189 WP_014573336.1 hypothetical protein Machinery gene
  LL1196_RS12125 (LL1196_2428) comGC 2314101..2314451 (-) 351 WP_050574401.1 competence type IV pilus major pilin ComGC Machinery gene
  LL1196_RS12130 (LL1196_2429) comGB 2314496..2315521 (-) 1026 WP_050574400.1 competence type IV pilus assembly protein ComGB Machinery gene
  LL1196_RS12135 (LL1196_2430) - 2315421..2316242 (-) 822 Protein_2361 ATPase, T2SS/T4P/T4SS family -
  LL1196_RS12140 (LL1196_2431) - 2316345..2317235 (+) 891 WP_205536422.1 IS982 family transposase -
  LL1196_RS12145 (LL1196_2432) comGA 2317217..2317408 (-) 192 WP_014573341.1 hypothetical protein Machinery gene

Sequence


Protein


Download         Length: 99 a.a.        Molecular weight: 11240.23 Da        Isoelectric Point: 9.5415

>NTDB_id=314099 LL1196_RS12105 WP_011677181.1 2312711..2313010(-) (comGG) [Lactococcus cremoris strain 1196]
MVLLLIFSLFLQFYLQKQVLTAQQLKIEKERLTAELMVSLALKKDLKTSGQLNFDCGNLTYKLLTDLSADSTSGGQTVSN
KTYCFDVRLKDGRIFQIVK

Nucleotide


Download         Length: 300 bp        

>NTDB_id=314099 LL1196_RS12105 WP_011677181.1 2312711..2313010(-) (comGG) [Lactococcus cremoris strain 1196]
TTGGTTTTACTGCTAATTTTTTCTTTATTTCTACAGTTTTATTTGCAAAAACAGGTGCTTACAGCTCAGCAATTGAAAAT
AGAAAAGGAGCGACTGACAGCCGAATTAATGGTTTCATTGGCTCTTAAAAAGGATTTGAAAACGAGTGGTCAACTTAATT
TTGATTGTGGAAATTTAACTTACAAATTACTGACAGATCTGTCAGCTGATTCAACTAGCGGTGGTCAAACTGTTAGTAAT
AAAACTTATTGTTTTGATGTTCGGCTTAAGGATGGAAGAATTTTTCAAATAGTAAAGTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

98.99

100

0.99


Multiple sequence alignment