Detailed information NTG0314105

Bioinformatically predicted

Overview

• Name: comGA
• Type: Machinery gene
• Locus tag: LL1196_RS12145
• Genome accession: NZ_CP032148
• Coordinates: 2317217..2317408 (-)
• Length: 63 a.a.
• NCBI ID: WP_014573341.1
• Uniprot ID: A0A896TDC6
• Organism: Lactococcus cremoris strain 1196
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IScluster/Tn	2314551..2318953	2317217..2317408	within	0

Gene organization within MGE regions

Location: 2314551..2318953

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LL1196_RS12135 (LL1196_2430)	-	2315421..2316242 (-)	822	Protein_2361	ATPase, T2SS/T4P/T4SS family	-
LL1196_RS12140 (LL1196_2431)	-	2316345..2317235 (+)	891	WP_205536422.1	IS982 family transposase	-
LL1196_RS12145 (LL1196_2432)	comGA	2317217..2317408 (-)	192	WP_014573341.1	hypothetical protein	Machinery gene

Sequence

Protein

• Length: 63 a.a.
• Molecular weight: 7255.51 Da
• Isoelectric Point: 4.3901

>NTDB_id=314105 LL1196_RS12145 WP_014573341.1 2317217..2317408(-) (comGA) [Lactococcus cremoris strain 1196]
MVQKKAQELIQKAIEMEASDIYLIASGNLYKIYIRQQLGRTLIEELNQEIGLPELLVDYLAMT

Nucleotide

• Length: 192 bp

>NTDB_id=314105 LL1196_RS12145 WP_014573341.1 2317217..2317408(-) (comGA) [Lactococcus cremoris strain 1196]
ATGGTACAGAAAAAAGCACAAGAACTCATTCAAAAGGCAATTGAGATGGAGGCTTCTGATATTTATTTAATTGCTTCAGG
AAATCTTTATAAGATATATATTCGTCAACAATTAGGGCGAACTTTAATAGAGGAACTTAACCAAGAGATTGGTTTACCCG
AATTGCTAGTTGATTATTTAGCCATGACTTGA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGA	Lactococcus lactis subsp. cremoris KW2	96.226	84.127	0.81