Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | D1F63_RS06510 | Genome accession | NZ_CP031770 |
| Coordinates | 1246313..1246495 (-) | Length | 60 a.a. |
| NCBI ID | WP_011528776.1 | Uniprot ID | A0A660A5W9 |
| Organism | Streptococcus pyogenes strain SASM4-Duke | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1246313..1274616 | 1246313..1246495 | within | 0 |
Gene organization within MGE regions
Location: 1246313..1274616
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D1F63_RS06510 (D1F63_06510) | prx | 1246313..1246495 (-) | 183 | WP_011528776.1 | hypothetical protein | Regulator |
| D1F63_RS06515 (D1F63_06515) | entC3 | 1246608..1247390 (-) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| D1F63_RS06520 (D1F63_06520) | - | 1247638..1248762 (-) | 1125 | WP_002988467.1 | Fic family protein | - |
| D1F63_RS06525 (D1F63_06525) | - | 1248898..1250115 (-) | 1218 | WP_011528778.1 | peptidoglycan amidohydrolase family protein | - |
| D1F63_RS06530 (D1F63_06530) | - | 1250234..1250461 (-) | 228 | WP_003058873.1 | phage holin | - |
| D1F63_RS06535 (D1F63_06535) | - | 1250458..1250730 (-) | 273 | WP_011017397.1 | hypothetical protein | - |
| D1F63_RS06540 (D1F63_06540) | - | 1250742..1251374 (-) | 633 | WP_011528779.1 | hypothetical protein | - |
| D1F63_RS06545 (D1F63_06545) | - | 1251377..1251805 (-) | 429 | WP_011528780.1 | DUF1617 family protein | - |
| D1F63_RS06550 (D1F63_06550) | - | 1251814..1253595 (-) | 1782 | WP_011528781.1 | gp58-like family protein | - |
| D1F63_RS06555 (D1F63_06555) | hylP | 1253610..1254725 (-) | 1116 | WP_011528782.1 | hyaluronoglucosaminidase | - |
| D1F63_RS06560 (D1F63_06560) | - | 1254722..1256698 (-) | 1977 | WP_011528783.1 | phage tail spike protein | - |
| D1F63_RS06565 (D1F63_06565) | - | 1256680..1257375 (-) | 696 | WP_002992579.1 | hypothetical protein | - |
| D1F63_RS06570 (D1F63_06570) | - | 1257372..1259729 (-) | 2358 | WP_011528784.1 | hypothetical protein | - |
| D1F63_RS06575 (D1F63_06575) | - | 1259729..1260100 (-) | 372 | WP_011528785.1 | DUF5361 domain-containing protein | - |
| D1F63_RS06580 (D1F63_06580) | - | 1260115..1260378 (-) | 264 | WP_003047548.1 | hypothetical protein | - |
| D1F63_RS06585 (D1F63_06585) | - | 1260389..1260967 (-) | 579 | WP_014635577.1 | hypothetical protein | - |
| D1F63_RS06595 (D1F63_06595) | - | 1261091..1261426 (-) | 336 | WP_011528787.1 | hypothetical protein | - |
| D1F63_RS06600 (D1F63_06600) | - | 1261427..1261663 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| D1F63_RS06605 (D1F63_06605) | - | 1261656..1261993 (-) | 338 | Protein_1229 | hypothetical protein | - |
| D1F63_RS06610 (D1F63_06610) | - | 1261953..1262375 (-) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| D1F63_RS06615 (D1F63_06615) | - | 1262385..1262585 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| D1F63_RS06620 (D1F63_06620) | - | 1262585..1263496 (-) | 912 | WP_011528788.1 | phage major capsid protein | - |
| D1F63_RS06625 (D1F63_06625) | - | 1263521..1263982 (-) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| D1F63_RS06630 (D1F63_06630) | - | 1264062..1265477 (-) | 1416 | WP_021299324.1 | phage terminase large subunit-like protein | - |
| D1F63_RS06635 (D1F63_06635) | - | 1265559..1265795 (-) | 237 | Protein_1235 | hypothetical protein | - |
| D1F63_RS06640 (D1F63_06640) | - | 1265797..1266063 (-) | 267 | WP_011054745.1 | hypothetical protein | - |
| D1F63_RS06645 (D1F63_06645) | - | 1266115..1266339 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| D1F63_RS06650 (D1F63_06650) | - | 1266345..1267838 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| D1F63_RS06655 (D1F63_06655) | - | 1267831..1269099 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| D1F63_RS06660 (D1F63_06660) | - | 1269096..1269452 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| D1F63_RS06665 (D1F63_06665) | - | 1269600..1269944 (-) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| D1F63_RS06670 (D1F63_06670) | - | 1270052..1270471 (-) | 420 | WP_011528791.1 | DUF1492 domain-containing protein | - |
| D1F63_RS06675 (D1F63_06675) | - | 1270650..1270977 (-) | 328 | Protein_1243 | recombinase RecT | - |
| D1F63_RS06680 (D1F63_06680) | - | 1270980..1271309 (-) | 330 | WP_011528796.1 | hypothetical protein | - |
| D1F63_RS06685 (D1F63_06685) | - | 1271365..1271571 (-) | 207 | WP_002988357.1 | hypothetical protein | - |
| D1F63_RS06690 (D1F63_06690) | - | 1271580..1271720 (-) | 141 | WP_002988354.1 | hypothetical protein | - |
| D1F63_RS06695 (D1F63_06695) | - | 1271717..1271951 (-) | 235 | Protein_1247 | hypothetical protein | - |
| D1F63_RS06700 (D1F63_06700) | - | 1271932..1272135 (-) | 204 | Protein_1248 | DNA replication protein | - |
| D1F63_RS06705 (D1F63_06705) | - | 1272132..1272728 (+) | 597 | Protein_1249 | tyrosine-type recombinase/integrase | - |
| D1F63_RS06710 (D1F63_06710) | - | 1272817..1273092 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| D1F63_RS06715 (D1F63_06715) | - | 1273191..1273778 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| D1F63_RS06720 (D1F63_06720) | - | 1273756..1274598 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6840.81 Da Isoelectric Point: 4.7023
>NTDB_id=311115 D1F63_RS06510 WP_011528776.1 1246313..1246495(-) (prx) [Streptococcus pyogenes strain SASM4-Duke]
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=311115 D1F63_RS06510 WP_011528776.1 1246313..1246495(-) (prx) [Streptococcus pyogenes strain SASM4-Duke]
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
81.395 |
71.667 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |