Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | D0Z58_RS07405 | Genome accession | NZ_CP031738 |
| Coordinates | 1422096..1422275 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain SP1336 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1422096..1462729 | 1422096..1422275 | within | 0 |
Gene organization within MGE regions
Location: 1422096..1462729
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D0Z58_RS07405 (D0Z58_07400) | prx | 1422096..1422275 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| D0Z58_RS07410 (D0Z58_07405) | sda1 | 1422514..1423686 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| D0Z58_RS07415 (D0Z58_07410) | - | 1423802..1424998 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| D0Z58_RS07420 (D0Z58_07415) | - | 1425125..1425310 (-) | 186 | WP_002988802.1 | holin | - |
| D0Z58_RS07425 (D0Z58_07420) | - | 1425307..1425606 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| D0Z58_RS07430 (D0Z58_07425) | - | 1425617..1426237 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| D0Z58_RS07435 (D0Z58_07430) | - | 1426240..1426401 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| D0Z58_RS07440 (D0Z58_07435) | - | 1426410..1428317 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| D0Z58_RS07445 (D0Z58_07440) | - | 1428328..1428963 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| D0Z58_RS07450 (D0Z58_07445) | - | 1428963..1430018 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| D0Z58_RS07455 (D0Z58_07450) | - | 1430015..1431997 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| D0Z58_RS07460 (D0Z58_07455) | - | 1432007..1432849 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| D0Z58_RS07465 (D0Z58_07460) | - | 1432861..1437243 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| D0Z58_RS07470 (D0Z58_07465) | - | 1437258..1437491 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| D0Z58_RS07475 (D0Z58_07470) | - | 1437566..1438021 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| D0Z58_RS07480 (D0Z58_07475) | - | 1438075..1438674 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| D0Z58_RS07485 (D0Z58_07480) | - | 1438686..1439045 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| D0Z58_RS07490 (D0Z58_07485) | - | 1439049..1439393 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| D0Z58_RS07495 (D0Z58_07490) | - | 1439390..1439668 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| D0Z58_RS07500 (D0Z58_07495) | - | 1439679..1440035 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| D0Z58_RS07505 (D0Z58_07500) | - | 1440047..1440934 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| D0Z58_RS07510 (D0Z58_07505) | - | 1440947..1441516 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| D0Z58_RS07515 (D0Z58_07510) | - | 1441672..1441938 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| D0Z58_RS07520 (D0Z58_07515) | - | 1441941..1442129 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| D0Z58_RS07525 (D0Z58_07520) | - | 1442160..1443605 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| D0Z58_RS07530 (D0Z58_07525) | - | 1443565..1445097 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| D0Z58_RS07535 (D0Z58_07530) | - | 1445113..1446390 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| D0Z58_RS07540 (D0Z58_07535) | - | 1446380..1446832 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| D0Z58_RS07545 (D0Z58_07540) | - | 1446922..1447338 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| D0Z58_RS07550 (D0Z58_07545) | - | 1447335..1447526 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| D0Z58_RS07555 (D0Z58_07550) | - | 1447516..1448367 (-) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| D0Z58_RS07560 (D0Z58_07555) | - | 1448376..1448642 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| D0Z58_RS09765 | - | 1448639..1448806 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| D0Z58_RS07565 (D0Z58_07560) | - | 1448807..1450129 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| D0Z58_RS07570 (D0Z58_07565) | - | 1450126..1450401 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| D0Z58_RS07575 (D0Z58_07570) | - | 1450788..1453172 (-) | 2385 | WP_002988726.1 | phage/plasmid primase, P4 family | - |
| D0Z58_RS07580 (D0Z58_07575) | - | 1453177..1455099 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| D0Z58_RS07585 (D0Z58_07580) | - | 1455142..1455699 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| D0Z58_RS07590 (D0Z58_07585) | - | 1455710..1456108 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| D0Z58_RS07595 (D0Z58_07590) | - | 1456112..1457266 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| D0Z58_RS07600 (D0Z58_07595) | - | 1457266..1457565 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| D0Z58_RS07605 (D0Z58_07600) | - | 1457653..1457856 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| D0Z58_RS07610 (D0Z58_07605) | - | 1458003..1458389 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| D0Z58_RS07615 (D0Z58_07610) | - | 1458386..1458589 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| D0Z58_RS07620 (D0Z58_07615) | - | 1458582..1458752 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| D0Z58_RS07625 (D0Z58_07620) | - | 1458749..1459024 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| D0Z58_RS07630 (D0Z58_07625) | - | 1459086..1459301 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| D0Z58_RS07635 (D0Z58_07630) | - | 1459349..1459762 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| D0Z58_RS09770 | - | 1459743..1459898 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| D0Z58_RS07640 (D0Z58_07635) | - | 1460224..1460574 (+) | 351 | WP_002988676.1 | helix-turn-helix transcriptional regulator | - |
| D0Z58_RS07645 (D0Z58_07640) | - | 1460588..1460971 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| D0Z58_RS07650 (D0Z58_07645) | - | 1460982..1461533 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| D0Z58_RS07655 (D0Z58_07650) | - | 1461650..1462729 (+) | 1080 | WP_002988667.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=310908 D0Z58_RS07405 WP_002988813.1 1422096..1422275(-) (prx) [Streptococcus pyogenes strain SP1336]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=310908 D0Z58_RS07405 WP_002988813.1 1422096..1422275(-) (prx) [Streptococcus pyogenes strain SP1336]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |