Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | D0Z58_RS06100 | Genome accession | NZ_CP031738 |
| Coordinates | 1173838..1174020 (-) | Length | 60 a.a. |
| NCBI ID | WP_011528776.1 | Uniprot ID | A0A660A5W9 |
| Organism | Streptococcus pyogenes strain SP1336 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1173838..1216031 | 1173838..1174020 | within | 0 |
Gene organization within MGE regions
Location: 1173838..1216031
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D0Z58_RS06100 (D0Z58_06095) | prx | 1173838..1174020 (-) | 183 | WP_011528776.1 | hypothetical protein | Regulator |
| D0Z58_RS06105 (D0Z58_06100) | entC3 | 1174133..1174915 (-) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| D0Z58_RS06110 (D0Z58_06105) | - | 1175163..1176287 (-) | 1125 | WP_002988467.1 | Fic family protein | - |
| D0Z58_RS06115 (D0Z58_06110) | - | 1176423..1177640 (-) | 1218 | WP_011528778.1 | peptidoglycan amidohydrolase family protein | - |
| D0Z58_RS06120 (D0Z58_06115) | - | 1177759..1177986 (-) | 228 | WP_003058873.1 | phage holin | - |
| D0Z58_RS06125 (D0Z58_06120) | - | 1177983..1178255 (-) | 273 | WP_019418840.1 | hypothetical protein | - |
| D0Z58_RS06130 (D0Z58_06125) | - | 1178265..1178882 (-) | 618 | WP_011017592.1 | DUF1366 domain-containing protein | - |
| D0Z58_RS06135 (D0Z58_06130) | - | 1178885..1179316 (-) | 432 | WP_002983467.1 | DUF1617 family protein | - |
| D0Z58_RS06140 (D0Z58_06135) | - | 1179328..1181214 (-) | 1887 | WP_129796259.1 | gp58-like family protein | - |
| D0Z58_RS06145 (D0Z58_06140) | - | 1181227..1182237 (-) | 1011 | WP_011017589.1 | hyaluronoglucosaminidase | - |
| D0Z58_RS06150 (D0Z58_06145) | - | 1182234..1184378 (-) | 2145 | WP_011527560.1 | phage tail spike protein | - |
| D0Z58_RS06155 (D0Z58_06150) | - | 1184375..1185082 (-) | 708 | WP_011527559.1 | distal tail protein Dit | - |
| D0Z58_RS06160 (D0Z58_06155) | - | 1185082..1189003 (-) | 3922 | Protein_1136 | phage tail tape measure protein | - |
| D0Z58_RS06165 (D0Z58_06160) | - | 1189159..1189531 (-) | 373 | Protein_1137 | hypothetical protein | - |
| D0Z58_RS06170 (D0Z58_06165) | - | 1189544..1190186 (-) | 643 | Protein_1138 | major tail protein | - |
| D0Z58_RS06175 (D0Z58_06170) | - | 1190158..1190621 (-) | 464 | Protein_1139 | hypothetical protein | - |
| D0Z58_RS06180 (D0Z58_06175) | - | 1190618..1190994 (-) | 377 | Protein_1140 | HK97-gp10 family putative phage morphogenesis protein | - |
| D0Z58_RS06185 (D0Z58_06180) | - | 1190991..1191337 (-) | 347 | Protein_1141 | phage head closure protein | - |
| D0Z58_RS06190 (D0Z58_06185) | - | 1191297..1191634 (-) | 338 | Protein_1142 | head-tail connector protein | - |
| D0Z58_RS10005 | - | 1191637..1191765 (-) | 129 | WP_001118388.1 | hypothetical protein | - |
| D0Z58_RS10010 (D0Z58_06190) | - | 1191779..1193017 (-) | 1239 | Protein_1144 | phage major capsid protein | - |
| D0Z58_RS06200 (D0Z58_06195) | - | 1193003..1193649 (-) | 647 | Protein_1145 | head maturation protease, ClpP-related | - |
| D0Z58_RS06205 (D0Z58_06200) | - | 1193627..1194844 (-) | 1218 | Protein_1146 | phage portal protein | - |
| D0Z58_RS06210 (D0Z58_06205) | - | 1194874..1195098 (-) | 225 | WP_002985363.1 | hypothetical protein | - |
| D0Z58_RS06215 (D0Z58_06210) | - | 1195256..1196998 (-) | 1743 | Protein_1148 | terminase TerL endonuclease subunit | - |
| D0Z58_RS06220 (D0Z58_06215) | - | 1197063..1197230 (-) | 168 | WP_238666115.1 | hypothetical protein | - |
| D0Z58_RS06225 (D0Z58_06220) | - | 1197232..1197696 (-) | 465 | Protein_1150 | phage terminase small subunit P27 family | - |
| D0Z58_RS06230 (D0Z58_06225) | - | 1197845..1198198 (-) | 354 | WP_129796260.1 | HNH endonuclease signature motif containing protein | - |
| D0Z58_RS06240 (D0Z58_06235) | - | 1198433..1198615 (+) | 183 | WP_129796261.1 | type II toxin-antitoxin system HicA family toxin | - |
| D0Z58_RS06245 (D0Z58_06240) | - | 1198667..1199040 (+) | 374 | Protein_1153 | type II toxin-antitoxin system HicB family antitoxin | - |
| D0Z58_RS09910 | - | 1199358..1199783 (-) | 426 | WP_238666117.1 | hypothetical protein | - |
| D0Z58_RS09915 | - | 1199806..1200126 (-) | 321 | WP_238666119.1 | DNA adenine methylase | - |
| D0Z58_RS10055 (D0Z58_06250) | - | 1200705..1201157 (-) | 453 | Protein_1156 | DUF1492 domain-containing protein | - |
| D0Z58_RS09925 | - | 1201582..1201839 (-) | 258 | WP_340137735.1 | DUF1642 domain-containing protein | - |
| D0Z58_RS09930 | - | 1201872..1201964 (-) | 93 | Protein_1158 | DUF1642 domain-containing protein | - |
| D0Z58_RS09935 | - | 1202047..1202304 (-) | 258 | WP_238666123.1 | hypothetical protein | - |
| D0Z58_RS06270 (D0Z58_06265) | - | 1202352..1203116 (-) | 765 | WP_021299463.1 | site-specific DNA-methyltransferase | - |
| D0Z58_RS06275 (D0Z58_06270) | - | 1203106..1203588 (-) | 483 | WP_011017571.1 | class I SAM-dependent methyltransferase | - |
| D0Z58_RS06280 (D0Z58_06275) | - | 1203592..1203876 (-) | 285 | WP_011017570.1 | hypothetical protein | - |
| D0Z58_RS06285 (D0Z58_06280) | - | 1203873..1204286 (-) | 414 | WP_011017569.1 | YopX family protein | - |
| D0Z58_RS06290 (D0Z58_06285) | - | 1204296..1204565 (-) | 270 | WP_002987593.1 | hypothetical protein | - |
| D0Z58_RS06295 (D0Z58_06290) | - | 1204562..1204747 (-) | 186 | WP_011527551.1 | hypothetical protein | - |
| D0Z58_RS06300 (D0Z58_06295) | - | 1204740..1205021 (-) | 282 | WP_011527550.1 | nucleotide modification associated domain-containing protein | - |
| D0Z58_RS06305 (D0Z58_06300) | - | 1205146..1205502 (-) | 357 | WP_011527549.1 | hypothetical protein | - |
| D0Z58_RS06310 (D0Z58_06305) | - | 1205486..1205806 (-) | 321 | WP_011527548.1 | VRR-NUC domain-containing protein | - |
| D0Z58_RS06315 (D0Z58_06310) | - | 1205803..1206216 (-) | 414 | WP_011527547.1 | hypothetical protein | - |
| D0Z58_RS06320 (D0Z58_06315) | - | 1206478..1207953 (-) | 1476 | WP_011527546.1 | phage/plasmid primase, P4 family | - |
| D0Z58_RS06325 (D0Z58_06320) | - | 1207943..1208755 (-) | 813 | WP_011527545.1 | bifunctional DNA primase/polymerase | - |
| D0Z58_RS06330 (D0Z58_06325) | - | 1208758..1209216 (-) | 459 | WP_011527544.1 | DUF669 domain-containing protein | - |
| D0Z58_RS06335 (D0Z58_06330) | - | 1209232..1210461 (-) | 1230 | WP_026031990.1 | DEAD/DEAH box helicase | - |
| D0Z58_RS06340 (D0Z58_06335) | - | 1210563..1211255 (-) | 693 | WP_011527542.1 | AAA family ATPase | - |
| D0Z58_RS06345 (D0Z58_06340) | - | 1211242..1211532 (-) | 291 | WP_024623417.1 | hypothetical protein | - |
| D0Z58_RS06350 (D0Z58_06345) | - | 1211663..1211845 (-) | 183 | WP_008087492.1 | hypothetical protein | - |
| D0Z58_RS06355 (D0Z58_06350) | - | 1211833..1212045 (-) | 213 | WP_011527540.1 | hypothetical protein | - |
| D0Z58_RS09755 | - | 1212055..1212195 (-) | 141 | WP_011527539.1 | hypothetical protein | - |
| D0Z58_RS06360 (D0Z58_06355) | - | 1212192..1212437 (-) | 246 | WP_011527538.1 | hypothetical protein | - |
| D0Z58_RS06365 (D0Z58_06360) | - | 1212702..1212914 (-) | 213 | WP_010922479.1 | helix-turn-helix transcriptional regulator | - |
| D0Z58_RS06370 (D0Z58_06365) | - | 1213116..1213871 (+) | 756 | WP_010922480.1 | XRE family transcriptional regulator | - |
| D0Z58_RS06375 (D0Z58_06370) | - | 1213883..1214401 (+) | 519 | WP_011528799.1 | HIRAN domain-containing protein | - |
| D0Z58_RS06380 (D0Z58_06375) | - | 1214525..1215667 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| D0Z58_RS06385 (D0Z58_06380) | - | 1215756..1216031 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6840.81 Da Isoelectric Point: 4.7023
>NTDB_id=310901 D0Z58_RS06100 WP_011528776.1 1173838..1174020(-) (prx) [Streptococcus pyogenes strain SP1336]
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=310901 D0Z58_RS06100 WP_011528776.1 1173838..1174020(-) (prx) [Streptococcus pyogenes strain SP1336]
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
81.395 |
71.667 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |