Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DZL14_RS07480 | Genome accession | NZ_CP031640 |
| Coordinates | 1479399..1479578 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain MGAS7888 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1479399..1520097 | 1479399..1479578 | within | 0 |
Gene organization within MGE regions
Location: 1479399..1520097
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DZL14_RS07480 (DZL14_07470) | prx | 1479399..1479578 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| DZL14_RS07485 (DZL14_07475) | sda1 | 1479817..1480989 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| DZL14_RS07490 (DZL14_07480) | - | 1481105..1482301 (-) | 1197 | WP_129849042.1 | glucosaminidase domain-containing protein | - |
| DZL14_RS07495 (DZL14_07485) | - | 1482412..1482597 (-) | 186 | WP_011054731.1 | holin | - |
| DZL14_RS07500 (DZL14_07490) | - | 1482594..1482890 (-) | 297 | WP_011054732.1 | hypothetical protein | - |
| DZL14_RS07505 (DZL14_07495) | - | 1482901..1483512 (-) | 612 | WP_011054733.1 | DUF1366 domain-containing protein | - |
| DZL14_RS07510 (DZL14_07500) | - | 1483515..1483946 (-) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| DZL14_RS07515 (DZL14_07505) | - | 1483958..1485847 (-) | 1890 | WP_129849036.1 | gp58-like family protein | - |
| DZL14_RS07520 (DZL14_07510) | - | 1485858..1486172 (-) | 315 | WP_021340983.1 | hypothetical protein | - |
| DZL14_RS07525 (DZL14_07515) | - | 1486174..1487388 (-) | 1215 | WP_129849044.1 | hypothetical protein | - |
| DZL14_RS07530 (DZL14_07520) | - | 1487385..1489367 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| DZL14_RS07535 (DZL14_07525) | - | 1489377..1490219 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| DZL14_RS07540 (DZL14_07530) | - | 1490231..1494613 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| DZL14_RS07545 (DZL14_07535) | - | 1494628..1494861 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| DZL14_RS07550 (DZL14_07540) | - | 1494936..1495391 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| DZL14_RS07555 (DZL14_07545) | - | 1495445..1496044 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| DZL14_RS07560 (DZL14_07550) | - | 1496056..1496415 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| DZL14_RS07565 (DZL14_07555) | - | 1496419..1496763 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DZL14_RS07570 (DZL14_07560) | - | 1496760..1497038 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| DZL14_RS07575 (DZL14_07565) | - | 1497049..1497405 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| DZL14_RS07580 (DZL14_07570) | - | 1497417..1498304 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| DZL14_RS07585 (DZL14_07575) | - | 1498317..1498886 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| DZL14_RS07590 (DZL14_07580) | - | 1499042..1499308 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| DZL14_RS07595 (DZL14_07585) | - | 1499311..1499499 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| DZL14_RS07600 (DZL14_07590) | - | 1499530..1500975 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| DZL14_RS07605 (DZL14_07595) | - | 1500935..1502467 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| DZL14_RS07610 (DZL14_07600) | - | 1502483..1503760 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| DZL14_RS07615 (DZL14_07605) | - | 1503750..1504202 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| DZL14_RS07620 (DZL14_07610) | - | 1504292..1504708 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| DZL14_RS07625 (DZL14_07615) | - | 1504705..1504896 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| DZL14_RS07630 (DZL14_07620) | - | 1504886..1505737 (-) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| DZL14_RS07635 (DZL14_07625) | - | 1505746..1506012 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| DZL14_RS10035 | - | 1506009..1506176 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| DZL14_RS07640 (DZL14_07630) | - | 1506177..1507499 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| DZL14_RS07645 (DZL14_07635) | - | 1507496..1507770 (-) | 275 | Protein_1424 | VRR-NUC domain-containing protein | - |
| DZL14_RS07650 (DZL14_07640) | - | 1508157..1510541 (-) | 2385 | WP_002988726.1 | phage/plasmid primase, P4 family | - |
| DZL14_RS07655 (DZL14_07645) | - | 1510546..1512468 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| DZL14_RS07660 (DZL14_07650) | - | 1512511..1513068 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| DZL14_RS07665 (DZL14_07655) | - | 1513079..1513477 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| DZL14_RS07670 (DZL14_07660) | - | 1513481..1514635 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| DZL14_RS07675 (DZL14_07665) | - | 1514635..1514934 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| DZL14_RS07680 (DZL14_07670) | - | 1515022..1515225 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| DZL14_RS10040 | - | 1515222..1515374 (-) | 153 | WP_011285675.1 | hypothetical protein | - |
| DZL14_RS07685 (DZL14_07675) | - | 1515371..1515757 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| DZL14_RS07695 (DZL14_07685) | - | 1515950..1516120 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| DZL14_RS07700 (DZL14_07690) | - | 1516117..1516392 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| DZL14_RS07705 (DZL14_07695) | - | 1516454..1516669 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| DZL14_RS07710 (DZL14_07700) | - | 1516717..1517130 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| DZL14_RS10045 | - | 1517111..1517266 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| DZL14_RS07715 (DZL14_07705) | - | 1517592..1517942 (+) | 351 | WP_002988676.1 | helix-turn-helix transcriptional regulator | - |
| DZL14_RS07720 (DZL14_07710) | - | 1517956..1518339 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DZL14_RS07725 (DZL14_07715) | - | 1518350..1518901 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| DZL14_RS07730 (DZL14_07720) | - | 1519018..1520097 (+) | 1080 | WP_002988667.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=309231 DZL14_RS07480 WP_002988813.1 1479399..1479578(-) (prx) [Streptococcus pyogenes strain MGAS7888]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=309231 DZL14_RS07480 WP_002988813.1 1479399..1479578(-) (prx) [Streptococcus pyogenes strain MGAS7888]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |