Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DZL40_RS04375 | Genome accession | NZ_CP031639 |
| Coordinates | 848478..848666 (+) | Length | 62 a.a. |
| NCBI ID | WP_002993136.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS7914 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 801724..850783 | 848478..848666 | within | 0 |
Gene organization within MGE regions
Location: 801724..850783
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DZL40_RS04030 (DZL40_04030) | - | 801724..802344 (-) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
| DZL40_RS04035 (DZL40_04035) | - | 802707..803795 (-) | 1089 | WP_023079773.1 | site-specific integrase | - |
| DZL40_RS04040 (DZL40_04040) | - | 804045..804854 (-) | 810 | WP_002984270.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| DZL40_RS04045 (DZL40_04045) | - | 804867..805610 (-) | 744 | WP_011284884.1 | S24 family peptidase | - |
| DZL40_RS09640 | - | 805968..806117 (+) | 150 | WP_021340643.1 | hypothetical protein | - |
| DZL40_RS04050 (DZL40_04050) | - | 806103..806318 (-) | 216 | WP_021341080.1 | hypothetical protein | - |
| DZL40_RS04055 (DZL40_04055) | - | 806377..806535 (+) | 159 | WP_011284883.1 | hypothetical protein | - |
| DZL40_RS04060 (DZL40_04060) | - | 806565..807164 (-) | 600 | WP_011284882.1 | hypothetical protein | - |
| DZL40_RS04065 (DZL40_04065) | - | 807218..807427 (+) | 210 | WP_011284881.1 | hypothetical protein | - |
| DZL40_RS04070 (DZL40_04070) | - | 807416..807802 (-) | 387 | WP_011054589.1 | hypothetical protein | - |
| DZL40_RS04075 (DZL40_04075) | - | 807876..808103 (+) | 228 | WP_002984281.1 | hypothetical protein | - |
| DZL40_RS04080 (DZL40_04080) | - | 808211..808720 (-) | 510 | WP_129846768.1 | hypothetical protein | - |
| DZL40_RS04090 (DZL40_04090) | - | 808979..809188 (-) | 210 | WP_002984292.1 | hypothetical protein | - |
| DZL40_RS04095 (DZL40_04095) | - | 809338..809577 (-) | 240 | WP_011284879.1 | hypothetical protein | - |
| DZL40_RS04100 (DZL40_04100) | - | 809744..809929 (+) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| DZL40_RS04105 (DZL40_04105) | - | 810008..810304 (+) | 297 | WP_011017882.1 | MerR family transcriptional regulator | - |
| DZL40_RS04110 (DZL40_04110) | - | 810301..810438 (+) | 138 | WP_011017881.1 | hypothetical protein | - |
| DZL40_RS04115 (DZL40_04115) | - | 810519..810848 (+) | 330 | WP_011284878.1 | hypothetical protein | - |
| DZL40_RS04120 (DZL40_04120) | - | 810848..811042 (+) | 195 | WP_002984315.1 | hypothetical protein | - |
| DZL40_RS04125 (DZL40_04125) | - | 811039..811323 (+) | 285 | WP_011284877.1 | hypothetical protein | - |
| DZL40_RS04130 (DZL40_04130) | - | 811320..812003 (+) | 684 | WP_002984321.1 | AAA family ATPase | - |
| DZL40_RS04135 (DZL40_04135) | - | 812009..813442 (+) | 1434 | Protein_740 | DEAD/DEAH box helicase | - |
| DZL40_RS04140 (DZL40_04140) | - | 813447..813929 (+) | 483 | WP_002984328.1 | DUF669 domain-containing protein | - |
| DZL40_RS04145 (DZL40_04145) | - | 813947..815500 (+) | 1554 | WP_011284875.1 | hypothetical protein | - |
| DZL40_RS04150 (DZL40_04150) | - | 815769..816638 (+) | 870 | WP_014635521.1 | bifunctional DNA primase/polymerase | - |
| DZL40_RS04155 (DZL40_04155) | - | 816658..816942 (+) | 285 | WP_011284874.1 | VRR-NUC domain-containing protein | - |
| DZL40_RS04160 (DZL40_04160) | - | 816926..817282 (+) | 357 | WP_011284873.1 | hypothetical protein | - |
| DZL40_RS09940 (DZL40_04165) | - | 817279..817524 (+) | 246 | WP_011284872.1 | hypothetical protein | - |
| DZL40_RS04170 (DZL40_04170) | - | 817524..817760 (+) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| DZL40_RS09645 | - | 817757..817927 (+) | 171 | WP_002995952.1 | hypothetical protein | - |
| DZL40_RS04175 (DZL40_04175) | - | 817924..818208 (+) | 285 | WP_011284869.1 | hypothetical protein | - |
| DZL40_RS04180 (DZL40_04180) | - | 818210..818842 (+) | 633 | WP_011888685.1 | N-6 DNA methylase | - |
| DZL40_RS04185 (DZL40_04185) | - | 818847..819326 (+) | 480 | WP_011888686.1 | DUF1642 domain-containing protein | - |
| DZL40_RS09650 | - | 819323..819493 (+) | 171 | WP_002987493.1 | hypothetical protein | - |
| DZL40_RS04190 (DZL40_04190) | - | 819775..820209 (+) | 435 | WP_011284866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DZL40_RS04200 (DZL40_04200) | - | 820787..821701 (+) | 915 | WP_011284864.1 | hypothetical protein | - |
| DZL40_RS09655 | - | 821791..822024 (-) | 234 | WP_002995461.1 | hypothetical protein | - |
| DZL40_RS04210 (DZL40_04210) | - | 822319..822696 (-) | 378 | WP_002987543.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| DZL40_RS04215 (DZL40_04215) | - | 822748..822933 (-) | 186 | WP_001132273.1 | type II toxin-antitoxin system HicA family toxin | - |
| DZL40_RS04220 (DZL40_04220) | - | 823032..823463 (+) | 432 | WP_023079766.1 | terminase small subunit | - |
| DZL40_RS04225 (DZL40_04225) | - | 823441..824748 (+) | 1308 | WP_020833530.1 | PBSX family phage terminase large subunit | - |
| DZL40_RS04230 (DZL40_04230) | - | 824760..826262 (+) | 1503 | WP_002984369.1 | phage portal protein | - |
| DZL40_RS04235 (DZL40_04235) | - | 826243..827805 (+) | 1563 | WP_011284860.1 | phage head morphogenesis protein | - |
| DZL40_RS04240 (DZL40_04240) | - | 827809..827994 (+) | 186 | WP_002988389.1 | hypothetical protein | - |
| DZL40_RS04245 (DZL40_04245) | - | 828064..828378 (+) | 315 | WP_011284859.1 | hypothetical protein | - |
| DZL40_RS04250 (DZL40_04250) | - | 828381..828647 (+) | 267 | WP_011284858.1 | hypothetical protein | - |
| DZL40_RS04255 (DZL40_04255) | - | 828791..829324 (+) | 534 | WP_023079765.1 | DUF4355 domain-containing protein | - |
| DZL40_RS04260 (DZL40_04260) | - | 829334..829714 (+) | 381 | WP_011284856.1 | head decoration protein | - |
| DZL40_RS04265 (DZL40_04265) | - | 829717..830799 (+) | 1083 | WP_011284855.1 | major capsid protein | - |
| DZL40_RS04270 (DZL40_04270) | - | 830809..831051 (+) | 243 | WP_011284854.1 | HeH/LEM domain-containing protein | - |
| DZL40_RS04275 (DZL40_04275) | - | 831065..831418 (+) | 354 | WP_002984392.1 | phage head-tail connector protein | - |
| DZL40_RS04280 (DZL40_04280) | - | 831415..831723 (+) | 309 | WP_011284852.1 | hypothetical protein | - |
| DZL40_RS04285 (DZL40_04285) | - | 831704..832069 (+) | 366 | WP_030126607.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DZL40_RS04290 (DZL40_04290) | - | 832066..832455 (+) | 390 | WP_011284850.1 | hypothetical protein | - |
| DZL40_RS04295 (DZL40_04295) | - | 832510..833133 (+) | 624 | WP_030126608.1 | phage major tail protein, TP901-1 family | - |
| DZL40_RS04300 (DZL40_04300) | - | 833187..833540 (+) | 354 | WP_002990023.1 | tail assembly chaperone | - |
| DZL40_RS04305 (DZL40_04305) | - | 833615..833911 (+) | 297 | WP_021340179.1 | hypothetical protein | - |
| DZL40_RS04310 (DZL40_04310) | - | 833926..837561 (+) | 3636 | WP_011284846.1 | tape measure protein | - |
| DZL40_RS04315 (DZL40_04315) | - | 837593..838372 (+) | 780 | WP_011284845.1 | distal tail protein Dit | - |
| DZL40_RS04320 (DZL40_04320) | - | 838369..840423 (+) | 2055 | WP_011284844.1 | phage tail spike protein | - |
| DZL40_RS04325 (DZL40_04325) | - | 840420..841634 (+) | 1215 | WP_011284843.1 | hypothetical protein | - |
| DZL40_RS04330 (DZL40_04330) | - | 841636..841950 (+) | 315 | WP_021340983.1 | hypothetical protein | - |
| DZL40_RS04335 (DZL40_04335) | - | 841961..843856 (+) | 1896 | WP_011284841.1 | gp58-like family protein | - |
| DZL40_RS04340 (DZL40_04340) | - | 843870..844031 (+) | 162 | WP_002988795.1 | hypothetical protein | - |
| DZL40_RS04345 (DZL40_04345) | - | 844034..844651 (+) | 618 | WP_011284840.1 | hypothetical protein | - |
| DZL40_RS04350 (DZL40_04350) | - | 844662..844958 (+) | 297 | WP_002990012.1 | hypothetical protein | - |
| DZL40_RS04355 (DZL40_04355) | - | 844955..845140 (+) | 186 | WP_011284839.1 | holin | - |
| DZL40_RS04360 (DZL40_04360) | - | 845252..846586 (+) | 1335 | WP_011284838.1 | GH25 family lysozyme | - |
| DZL40_RS04365 (DZL40_04365) | speC | 846662..847369 (-) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| DZL40_RS04370 (DZL40_04370) | mf2 | 847480..848238 (-) | 759 | WP_011184727.1 | DNase Mf2 | - |
| DZL40_RS04375 (DZL40_04375) | prx | 848478..848666 (+) | 189 | WP_002993136.1 | hypothetical protein | Regulator |
| DZL40_RS04385 (DZL40_04385) | - | 849257..849871 (+) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| DZL40_RS04390 (DZL40_04390) | - | 849998..850783 (-) | 786 | WP_002984433.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7239.28 Da Isoelectric Point: 3.9944
>NTDB_id=309165 DZL40_RS04375 WP_002993136.1 848478..848666(+) (prx) [Streptococcus pyogenes strain MGAS7914]
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=309165 DZL40_RS04375 WP_002993136.1 848478..848666(+) (prx) [Streptococcus pyogenes strain MGAS7914]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85.484 |
100 |
0.855 |
| prx | Streptococcus pyogenes MGAS8232 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
79.31 |
93.548 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
95.238 |
67.742 |
0.645 |
| prx | Streptococcus pyogenes MGAS315 |
80.488 |
66.129 |
0.532 |