Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DZM45_RS02475 | Genome accession | NZ_CP031638 |
| Coordinates | 463958..464137 (+) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain MGAS8347 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 423687..464137 | 463958..464137 | within | 0 |
Gene organization within MGE regions
Location: 423687..464137
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DZM45_RS02225 (DZM45_02225) | - | 423687..424766 (-) | 1080 | WP_002988667.1 | tyrosine-type recombinase/integrase | - |
| DZM45_RS02230 (DZM45_02230) | - | 424883..425434 (-) | 552 | WP_002988670.1 | hypothetical protein | - |
| DZM45_RS02235 (DZM45_02235) | - | 425445..425828 (-) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DZM45_RS02240 (DZM45_02240) | - | 425842..426192 (-) | 351 | WP_002988676.1 | helix-turn-helix transcriptional regulator | - |
| DZM45_RS09165 | - | 426518..426673 (+) | 156 | WP_002988678.1 | hypothetical protein | - |
| DZM45_RS02245 (DZM45_02245) | - | 426654..427067 (-) | 414 | WP_002988681.1 | hypothetical protein | - |
| DZM45_RS02250 (DZM45_02250) | - | 427115..427330 (+) | 216 | WP_002988684.1 | hypothetical protein | - |
| DZM45_RS02255 (DZM45_02255) | - | 427392..427667 (+) | 276 | WP_002988687.1 | hypothetical protein | - |
| DZM45_RS02260 (DZM45_02260) | - | 427664..427834 (+) | 171 | WP_002988693.1 | hypothetical protein | - |
| DZM45_RS02265 (DZM45_02265) | - | 427827..428030 (+) | 204 | WP_002988697.1 | hypothetical protein | - |
| DZM45_RS02270 (DZM45_02270) | - | 428027..428413 (+) | 387 | WP_002988700.1 | hypothetical protein | - |
| DZM45_RS02275 (DZM45_02275) | - | 428560..428763 (+) | 204 | WP_002988705.1 | hypothetical protein | - |
| DZM45_RS02280 (DZM45_02280) | - | 428851..429150 (+) | 300 | WP_002988708.1 | hypothetical protein | - |
| DZM45_RS02285 (DZM45_02285) | - | 429150..430304 (+) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| DZM45_RS02290 (DZM45_02290) | - | 430308..430706 (+) | 399 | WP_002988715.1 | hypothetical protein | - |
| DZM45_RS02295 (DZM45_02295) | - | 430717..431274 (+) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| DZM45_RS02300 (DZM45_02300) | - | 431317..433239 (+) | 1923 | WP_002988723.1 | DNA polymerase | - |
| DZM45_RS02305 (DZM45_02305) | - | 433244..435628 (+) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| DZM45_RS02310 (DZM45_02310) | - | 436015..436290 (+) | 276 | WP_032461521.1 | VRR-NUC domain-containing protein | - |
| DZM45_RS02315 (DZM45_02315) | - | 436287..437609 (+) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| DZM45_RS09170 | - | 437610..437777 (+) | 168 | WP_002988735.1 | hypothetical protein | - |
| DZM45_RS02320 (DZM45_02320) | - | 437774..438040 (+) | 267 | WP_002988738.1 | hypothetical protein | - |
| DZM45_RS02325 (DZM45_02325) | - | 438049..438900 (+) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| DZM45_RS02330 (DZM45_02330) | - | 438890..439081 (+) | 192 | WP_002988743.1 | hypothetical protein | - |
| DZM45_RS02335 (DZM45_02335) | - | 439078..439494 (+) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| DZM45_RS02340 (DZM45_02340) | - | 439584..440036 (+) | 453 | WP_011106637.1 | terminase small subunit | - |
| DZM45_RS02345 (DZM45_02345) | - | 440026..441303 (+) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| DZM45_RS02350 (DZM45_02350) | - | 441319..442851 (+) | 1533 | WP_002988758.1 | phage portal protein | - |
| DZM45_RS02355 (DZM45_02355) | - | 442811..444256 (+) | 1446 | WP_015446273.1 | minor capsid protein | - |
| DZM45_RS02360 (DZM45_02360) | - | 444287..444475 (+) | 189 | WP_002983423.1 | hypothetical protein | - |
| DZM45_RS02365 (DZM45_02365) | - | 444478..444744 (+) | 267 | WP_002988765.1 | hypothetical protein | - |
| DZM45_RS02370 (DZM45_02370) | - | 444900..445469 (+) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| DZM45_RS02375 (DZM45_02375) | - | 445482..446369 (+) | 888 | WP_002988771.1 | hypothetical protein | - |
| DZM45_RS02380 (DZM45_02380) | - | 446381..446737 (+) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| DZM45_RS02385 (DZM45_02385) | - | 446748..447026 (+) | 279 | WP_000639437.1 | hypothetical protein | - |
| DZM45_RS02390 (DZM45_02390) | - | 447023..447367 (+) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DZM45_RS02395 (DZM45_02395) | - | 447371..447730 (+) | 360 | WP_002988782.1 | hypothetical protein | - |
| DZM45_RS02400 (DZM45_02400) | - | 447742..448341 (+) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| DZM45_RS02405 (DZM45_02405) | - | 448395..448850 (+) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| DZM45_RS02410 (DZM45_02410) | - | 448925..449158 (+) | 234 | WP_002983445.1 | hypothetical protein | - |
| DZM45_RS02415 (DZM45_02415) | - | 449173..453555 (+) | 4383 | WP_002988786.1 | tape measure protein | - |
| DZM45_RS02420 (DZM45_02420) | - | 453567..454409 (+) | 843 | WP_002988788.1 | phage tail family protein | - |
| DZM45_RS02425 (DZM45_02425) | - | 454419..456401 (+) | 1983 | WP_002988790.1 | phage tail protein | - |
| DZM45_RS02430 (DZM45_02430) | - | 456398..457612 (+) | 1215 | WP_129796275.1 | hypothetical protein | - |
| DZM45_RS02435 (DZM45_02435) | - | 457614..457928 (+) | 315 | WP_021340983.1 | hypothetical protein | - |
| DZM45_RS02440 (DZM45_02440) | - | 457939..459834 (+) | 1896 | WP_129796276.1 | gp58-like family protein | - |
| DZM45_RS02445 (DZM45_02445) | - | 459848..460009 (+) | 162 | WP_002988795.1 | hypothetical protein | - |
| DZM45_RS02450 (DZM45_02450) | - | 460012..460632 (+) | 621 | WP_002988797.1 | hypothetical protein | - |
| DZM45_RS02455 (DZM45_02455) | - | 460643..460942 (+) | 300 | WP_002988799.1 | hypothetical protein | - |
| DZM45_RS02460 (DZM45_02460) | - | 460939..461124 (+) | 186 | WP_002988802.1 | holin | - |
| DZM45_RS02465 (DZM45_02465) | - | 461235..462431 (+) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| DZM45_RS02470 (DZM45_02470) | sda1 | 462547..463719 (-) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| DZM45_RS02475 (DZM45_02475) | prx | 463958..464137 (+) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=309104 DZM45_RS02475 WP_002988813.1 463958..464137(+) (prx) [Streptococcus pyogenes strain MGAS8347]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=309104 DZM45_RS02475 WP_002988813.1 463958..464137(+) (prx) [Streptococcus pyogenes strain MGAS8347]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |