Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DZN22_RS03945 | Genome accession | NZ_CP031637 |
| Coordinates | 767609..767791 (+) | Length | 60 a.a. |
| NCBI ID | WP_003056293.1 | Uniprot ID | A0A5S4TFM2 |
| Organism | Streptococcus pyogenes strain MGAS10786 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 707724..767791 | 767609..767791 | within | 0 |
Gene organization within MGE regions
Location: 707724..767791
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DZN22_RS03610 (DZN22_03610) | - | 707724..708880 (-) | 1157 | Protein_635 | IS3 family transposase | - |
| DZN22_RS03615 (DZN22_03615) | - | 708976..710289 (-) | 1314 | WP_011284932.1 | chloride channel protein | - |
| DZN22_RS03620 (DZN22_03620) | nrdF | 710264..711223 (-) | 960 | WP_011017933.1 | class 1b ribonucleoside-diphosphate reductase subunit beta | - |
| DZN22_RS03625 (DZN22_03625) | nrdE | 711556..713715 (-) | 2160 | WP_002993430.1 | class 1b ribonucleoside-diphosphate reductase subunit alpha | - |
| DZN22_RS03630 (DZN22_03630) | - | 713735..713953 (-) | 219 | WP_002989242.1 | redoxin NrdH | - |
| DZN22_RS03635 (DZN22_03635) | - | 714346..714609 (+) | 264 | WP_002984031.1 | phosphocarrier protein HPr | - |
| DZN22_RS03640 (DZN22_03640) | ptsP | 714614..716347 (+) | 1734 | WP_002984033.1 | phosphoenolpyruvate--protein phosphotransferase | - |
| DZN22_RS03645 (DZN22_03645) | - | 716532..717959 (+) | 1428 | WP_011284931.1 | NADP-dependent glyceraldehyde-3-phosphate dehydrogenase | - |
| DZN22_RS03650 (DZN22_03650) | - | 718054..719328 (+) | 1275 | WP_011284930.1 | polysaccharide deacetylase family protein | - |
| DZN22_RS03655 (DZN22_03655) | - | 719438..720523 (-) | 1086 | WP_002989254.1 | DEAD/DEAH box helicase | - |
| DZN22_RS03660 (DZN22_03660) | udk | 720621..721247 (+) | 627 | WP_002984060.1 | uridine kinase | - |
| DZN22_RS03665 (DZN22_03665) | - | 721327..721590 (+) | 264 | WP_002989257.1 | DUF1294 domain-containing protein | - |
| DZN22_RS03670 (DZN22_03670) | - | 721643..722452 (-) | 810 | WP_002992609.1 | PrsW family intramembrane metalloprotease | - |
| DZN22_RS03675 (DZN22_03675) | - | 722597..723094 (+) | 498 | WP_009881127.1 | GAF domain-containing protein | - |
| DZN22_RS03680 (DZN22_03680) | dnaX | 723094..724779 (+) | 1686 | WP_011284927.1 | DNA polymerase III subunit gamma/tau | - |
| DZN22_RS03685 (DZN22_03685) | - | 725049..726182 (+) | 1134 | WP_044564887.1 | ISAs1-like element IS1548 family transposase | - |
| DZN22_RS03690 (DZN22_03690) | - | 726402..727556 (-) | 1155 | WP_080277749.1 | site-specific integrase | - |
| DZN22_RS03695 (DZN22_03695) | - | 727675..728196 (-) | 522 | WP_002986895.1 | hypothetical protein | - |
| DZN22_RS03700 (DZN22_03700) | - | 728207..728587 (-) | 381 | WP_002986894.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DZN22_RS03705 (DZN22_03705) | - | 728601..728960 (-) | 360 | WP_011054768.1 | helix-turn-helix transcriptional regulator | - |
| DZN22_RS03710 (DZN22_03710) | - | 729379..729474 (-) | 96 | WP_020837683.1 | type I toxin-antitoxin system Fst family toxin | - |
| DZN22_RS03715 (DZN22_03715) | - | 730109..730300 (+) | 192 | WP_002986891.1 | hypothetical protein | - |
| DZN22_RS03720 (DZN22_03720) | - | 730311..731039 (+) | 729 | WP_002986890.1 | phage antirepressor KilAC domain-containing protein | - |
| DZN22_RS09945 | - | 731072..731221 (+) | 150 | WP_002986888.1 | hypothetical protein | - |
| DZN22_RS03725 (DZN22_03725) | - | 731218..731418 (-) | 201 | WP_002986887.1 | KTSC domain-containing protein | - |
| DZN22_RS03730 (DZN22_03730) | - | 731497..731745 (+) | 249 | WP_023611035.1 | hypothetical protein | - |
| DZN22_RS03735 (DZN22_03735) | - | 731719..731934 (-) | 216 | WP_129820700.1 | hypothetical protein | - |
| DZN22_RS03740 (DZN22_03740) | - | 732041..732352 (+) | 312 | WP_014411880.1 | hypothetical protein | - |
| DZN22_RS03745 (DZN22_03745) | - | 732354..732524 (+) | 171 | WP_023611037.1 | hypothetical protein | - |
| DZN22_RS10250 (DZN22_03750) | - | 732517..732733 (+) | 217 | Protein_664 | hypothetical protein | - |
| DZN22_RS03755 (DZN22_03755) | - | 732730..733116 (+) | 387 | WP_111694890.1 | hypothetical protein | - |
| DZN22_RS03760 (DZN22_03760) | - | 733606..733809 (+) | 204 | WP_023611025.1 | hypothetical protein | - |
| DZN22_RS03765 (DZN22_03765) | - | 733898..734197 (+) | 300 | WP_002988708.1 | hypothetical protein | - |
| DZN22_RS03770 (DZN22_03770) | - | 734197..735354 (+) | 1158 | WP_023611034.1 | DUF2800 domain-containing protein | - |
| DZN22_RS03775 (DZN22_03775) | - | 735363..735926 (+) | 564 | WP_111674646.1 | DUF2815 family protein | - |
| DZN22_RS03780 (DZN22_03780) | - | 735969..737891 (+) | 1923 | WP_111674645.1 | DNA polymerase | - |
| DZN22_RS03785 (DZN22_03785) | - | 737896..740280 (+) | 2385 | WP_111688312.1 | phage/plasmid primase, P4 family | - |
| DZN22_RS03790 (DZN22_03790) | - | 740666..740941 (+) | 276 | WP_129820701.1 | VRR-NUC domain-containing protein | - |
| DZN22_RS03795 (DZN22_03795) | - | 740938..742260 (+) | 1323 | WP_111694889.1 | SNF2-related protein | - |
| DZN22_RS09950 | - | 742261..742431 (+) | 171 | WP_164972002.1 | hypothetical protein | - |
| DZN22_RS03800 (DZN22_03800) | - | 742424..742696 (+) | 273 | WP_011054882.1 | hypothetical protein | - |
| DZN22_RS03805 (DZN22_03805) | - | 742829..743245 (+) | 417 | WP_011054881.1 | transcriptional regulator | - |
| DZN22_RS03810 (DZN22_03810) | terS | 743365..744060 (+) | 696 | WP_050318691.1 | phage terminase small subunit | - |
| DZN22_RS03815 (DZN22_03815) | - | 744053..745348 (+) | 1296 | WP_165363098.1 | PBSX family phage terminase large subunit | - |
| DZN22_RS03820 (DZN22_03820) | - | 745362..746864 (+) | 1503 | WP_010922075.1 | phage portal protein | - |
| DZN22_RS03825 (DZN22_03825) | - | 746869..748347 (+) | 1479 | WP_111694888.1 | phage minor capsid protein | - |
| DZN22_RS03830 (DZN22_03830) | - | 748319..748558 (+) | 240 | WP_002986829.1 | hypothetical protein | - |
| DZN22_RS03835 (DZN22_03835) | - | 748620..748886 (+) | 267 | WP_111694887.1 | hypothetical protein | - |
| DZN22_RS03840 (DZN22_03840) | - | 749012..749626 (+) | 615 | WP_010922079.1 | hypothetical protein | - |
| DZN22_RS03845 (DZN22_03845) | - | 749630..750448 (+) | 819 | WP_111711357.1 | N4-gp56 family major capsid protein | - |
| DZN22_RS03850 (DZN22_03850) | - | 750502..750918 (+) | 417 | WP_111694886.1 | hypothetical protein | - |
| DZN22_RS03855 (DZN22_03855) | - | 750908..751240 (+) | 333 | WP_010922082.1 | minor capsid protein | - |
| DZN22_RS03860 (DZN22_03860) | - | 751240..751596 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| DZN22_RS03865 (DZN22_03865) | - | 751593..751991 (+) | 399 | WP_010922084.1 | minor capsid protein | - |
| DZN22_RS03870 (DZN22_03870) | - | 751991..752461 (+) | 471 | WP_011527917.1 | major tail shaft protein | - |
| DZN22_RS03875 (DZN22_03875) | - | 752514..752948 (+) | 435 | WP_010922086.1 | hypothetical protein | - |
| DZN22_RS03880 (DZN22_03880) | - | 752952..753533 (+) | 582 | WP_010922087.1 | bacteriophage Gp15 family protein | - |
| DZN22_RS03885 (DZN22_03885) | - | 753523..756783 (+) | 3261 | WP_129820702.1 | tape measure protein | - |
| DZN22_RS03890 (DZN22_03890) | - | 756780..757496 (+) | 717 | WP_111674636.1 | distal tail protein Dit | - |
| DZN22_RS03895 (DZN22_03895) | - | 757493..759640 (+) | 2148 | WP_129820703.1 | phage tail spike protein | - |
| DZN22_RS03900 (DZN22_03900) | - | 759637..760851 (+) | 1215 | WP_011284843.1 | hypothetical protein | - |
| DZN22_RS03905 (DZN22_03905) | - | 760853..761167 (+) | 315 | WP_021340983.1 | hypothetical protein | - |
| DZN22_RS03910 (DZN22_03910) | - | 761178..763064 (+) | 1887 | WP_129820704.1 | gp58-like family protein | - |
| DZN22_RS03915 (DZN22_03915) | - | 763076..763507 (+) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| DZN22_RS03920 (DZN22_03920) | - | 763510..764121 (+) | 612 | WP_129820705.1 | DUF1366 domain-containing protein | - |
| DZN22_RS03925 (DZN22_03925) | - | 764131..764403 (+) | 273 | WP_085613962.1 | hypothetical protein | - |
| DZN22_RS03930 (DZN22_03930) | - | 764400..764627 (+) | 228 | WP_003058873.1 | phage holin | - |
| DZN22_RS03935 (DZN22_03935) | - | 764743..765948 (+) | 1206 | WP_085613963.1 | glucosaminidase domain-containing protein | - |
| DZN22_RS03940 (DZN22_03940) | - | 766570..767370 (-) | 801 | WP_021340119.1 | DNA/RNA non-specific endonuclease | - |
| DZN22_RS03945 (DZN22_03945) | prx | 767609..767791 (+) | 183 | WP_003056293.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6877.91 Da Isoelectric Point: 4.2840
>NTDB_id=309058 DZN22_RS03945 WP_003056293.1 767609..767791(+) (prx) [Streptococcus pyogenes strain MGAS10786]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPGEPVKPWEILTEVIVEAVLRELDK
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPGEPVKPWEILTEVIVEAVLRELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=309058 DZN22_RS03945 WP_003056293.1 767609..767791(+) (prx) [Streptococcus pyogenes strain MGAS10786]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCTGGTGAGCCTGTGAAACCGTGGGAAATTTTGACTGAAGTAATAGTAGAAGCAG
TGCTGAGGGAATTAGACAAATAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCTGGTGAGCCTGTGAAACCGTGGGAAATTTTGACTGAAGTAATAGTAGAAGCAG
TGCTGAGGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS8232 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
68.333 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
78.049 |
68.333 |
0.533 |