Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DZQ17_RS04370 | Genome accession | NZ_CP031632 |
| Coordinates | 848518..848706 (+) | Length | 62 a.a. |
| NCBI ID | WP_002993136.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS28078 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 801769..850823 | 848518..848706 | within | 0 |
Gene organization within MGE regions
Location: 801769..850823
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DZQ17_RS04025 (DZQ17_04025) | - | 801769..802389 (-) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
| DZQ17_RS04030 (DZQ17_04030) | - | 802752..803840 (-) | 1089 | WP_023079773.1 | site-specific integrase | - |
| DZQ17_RS04035 (DZQ17_04035) | - | 804090..804899 (-) | 810 | WP_002984270.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| DZQ17_RS04040 (DZQ17_04040) | - | 804912..805655 (-) | 744 | WP_011284884.1 | S24 family peptidase | - |
| DZQ17_RS09540 | - | 806013..806162 (+) | 150 | WP_021340643.1 | hypothetical protein | - |
| DZQ17_RS04045 (DZQ17_04045) | - | 806148..806363 (-) | 216 | WP_021341080.1 | hypothetical protein | - |
| DZQ17_RS04050 (DZQ17_04050) | - | 806422..806580 (+) | 159 | WP_011284883.1 | hypothetical protein | - |
| DZQ17_RS04055 (DZQ17_04055) | - | 806610..807209 (-) | 600 | WP_011284882.1 | hypothetical protein | - |
| DZQ17_RS04060 (DZQ17_04060) | - | 807263..807472 (+) | 210 | WP_011284881.1 | hypothetical protein | - |
| DZQ17_RS04065 (DZQ17_04065) | - | 807461..807847 (-) | 387 | WP_011054589.1 | hypothetical protein | - |
| DZQ17_RS04070 (DZQ17_04070) | - | 807921..808148 (+) | 228 | WP_002984281.1 | hypothetical protein | - |
| DZQ17_RS04075 (DZQ17_04075) | - | 808256..808765 (-) | 510 | WP_011017884.1 | hypothetical protein | - |
| DZQ17_RS04085 (DZQ17_04085) | - | 809024..809233 (-) | 210 | WP_002984292.1 | hypothetical protein | - |
| DZQ17_RS04090 (DZQ17_04090) | - | 809383..809622 (-) | 240 | WP_011284879.1 | hypothetical protein | - |
| DZQ17_RS04095 (DZQ17_04095) | - | 809789..809974 (+) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| DZQ17_RS04100 (DZQ17_04100) | - | 810053..810349 (+) | 297 | WP_011017882.1 | MerR family transcriptional regulator | - |
| DZQ17_RS04105 (DZQ17_04105) | - | 810346..810483 (+) | 138 | WP_011017881.1 | hypothetical protein | - |
| DZQ17_RS04110 (DZQ17_04110) | - | 810564..810893 (+) | 330 | WP_011284878.1 | hypothetical protein | - |
| DZQ17_RS04115 (DZQ17_04115) | - | 810893..811087 (+) | 195 | WP_002984315.1 | hypothetical protein | - |
| DZQ17_RS04120 (DZQ17_04120) | - | 811084..811368 (+) | 285 | WP_011284877.1 | hypothetical protein | - |
| DZQ17_RS04125 (DZQ17_04125) | - | 811365..812048 (+) | 684 | WP_129821081.1 | AAA family ATPase | - |
| DZQ17_RS04130 (DZQ17_04130) | - | 812054..813487 (+) | 1434 | Protein_739 | DEAD/DEAH box helicase | - |
| DZQ17_RS04135 (DZQ17_04135) | - | 813492..813974 (+) | 483 | WP_002984328.1 | DUF669 domain-containing protein | - |
| DZQ17_RS04140 (DZQ17_04140) | - | 813992..815545 (+) | 1554 | WP_011284875.1 | hypothetical protein | - |
| DZQ17_RS04145 (DZQ17_04145) | - | 815809..816678 (+) | 870 | WP_014635521.1 | bifunctional DNA primase/polymerase | - |
| DZQ17_RS04150 (DZQ17_04150) | - | 816698..816982 (+) | 285 | WP_011284874.1 | VRR-NUC domain-containing protein | - |
| DZQ17_RS04155 (DZQ17_04155) | - | 816966..817322 (+) | 357 | WP_011284873.1 | hypothetical protein | - |
| DZQ17_RS09780 (DZQ17_04160) | - | 817319..817564 (+) | 246 | WP_011284872.1 | hypothetical protein | - |
| DZQ17_RS04165 (DZQ17_04165) | - | 817564..817800 (+) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| DZQ17_RS09545 | - | 817797..817967 (+) | 171 | WP_002995952.1 | hypothetical protein | - |
| DZQ17_RS04170 (DZQ17_04170) | - | 817964..818248 (+) | 285 | WP_011284869.1 | hypothetical protein | - |
| DZQ17_RS04175 (DZQ17_04175) | - | 818250..818882 (+) | 633 | WP_011888685.1 | N-6 DNA methylase | - |
| DZQ17_RS04180 (DZQ17_04180) | - | 818887..819366 (+) | 480 | WP_011888686.1 | DUF1642 domain-containing protein | - |
| DZQ17_RS09550 | - | 819363..819533 (+) | 171 | WP_002987493.1 | hypothetical protein | - |
| DZQ17_RS04185 (DZQ17_04185) | - | 819815..820249 (+) | 435 | WP_011284866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DZQ17_RS04195 (DZQ17_04195) | - | 820827..821741 (+) | 915 | WP_011284864.1 | hypothetical protein | - |
| DZQ17_RS09555 | - | 821831..822064 (-) | 234 | WP_002995461.1 | hypothetical protein | - |
| DZQ17_RS04205 (DZQ17_04205) | - | 822359..822736 (-) | 378 | WP_002987543.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| DZQ17_RS04210 (DZQ17_04210) | - | 822788..822973 (-) | 186 | WP_001132273.1 | type II toxin-antitoxin system HicA family toxin | - |
| DZQ17_RS04215 (DZQ17_04215) | - | 823072..823503 (+) | 432 | WP_023079766.1 | terminase small subunit | - |
| DZQ17_RS04220 (DZQ17_04220) | - | 823481..824788 (+) | 1308 | WP_020833530.1 | PBSX family phage terminase large subunit | - |
| DZQ17_RS04225 (DZQ17_04225) | - | 824800..826302 (+) | 1503 | WP_002984369.1 | phage portal protein | - |
| DZQ17_RS04230 (DZQ17_04230) | - | 826283..827845 (+) | 1563 | WP_011284860.1 | phage head morphogenesis protein | - |
| DZQ17_RS04235 (DZQ17_04235) | - | 827849..828034 (+) | 186 | WP_002988389.1 | hypothetical protein | - |
| DZQ17_RS04240 (DZQ17_04240) | - | 828104..828418 (+) | 315 | WP_011284859.1 | hypothetical protein | - |
| DZQ17_RS04245 (DZQ17_04245) | - | 828421..828687 (+) | 267 | WP_129821082.1 | hypothetical protein | - |
| DZQ17_RS04250 (DZQ17_04250) | - | 828831..829364 (+) | 534 | WP_023079765.1 | DUF4355 domain-containing protein | - |
| DZQ17_RS04255 (DZQ17_04255) | - | 829374..829754 (+) | 381 | WP_011284856.1 | head decoration protein | - |
| DZQ17_RS04260 (DZQ17_04260) | - | 829757..830839 (+) | 1083 | WP_011284855.1 | major capsid protein | - |
| DZQ17_RS04265 (DZQ17_04265) | - | 830849..831091 (+) | 243 | WP_011284854.1 | HeH/LEM domain-containing protein | - |
| DZQ17_RS04270 (DZQ17_04270) | - | 831105..831458 (+) | 354 | WP_002984392.1 | phage head-tail connector protein | - |
| DZQ17_RS04275 (DZQ17_04275) | - | 831455..831763 (+) | 309 | WP_011284852.1 | hypothetical protein | - |
| DZQ17_RS04280 (DZQ17_04280) | - | 831744..832109 (+) | 366 | WP_030126607.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DZQ17_RS04285 (DZQ17_04285) | - | 832106..832495 (+) | 390 | WP_011284850.1 | hypothetical protein | - |
| DZQ17_RS04290 (DZQ17_04290) | - | 832550..833173 (+) | 624 | WP_030126608.1 | phage major tail protein, TP901-1 family | - |
| DZQ17_RS04295 (DZQ17_04295) | - | 833227..833580 (+) | 354 | WP_002990023.1 | tail assembly chaperone | - |
| DZQ17_RS04300 (DZQ17_04300) | - | 833655..833951 (+) | 297 | WP_021340179.1 | hypothetical protein | - |
| DZQ17_RS04305 (DZQ17_04305) | - | 833966..837601 (+) | 3636 | WP_011284846.1 | tape measure protein | - |
| DZQ17_RS04310 (DZQ17_04310) | - | 837633..838412 (+) | 780 | WP_011284845.1 | distal tail protein Dit | - |
| DZQ17_RS04315 (DZQ17_04315) | - | 838409..840463 (+) | 2055 | WP_011284844.1 | phage tail spike protein | - |
| DZQ17_RS04320 (DZQ17_04320) | - | 840460..841674 (+) | 1215 | WP_011284843.1 | hypothetical protein | - |
| DZQ17_RS04325 (DZQ17_04325) | - | 841676..841990 (+) | 315 | WP_021340983.1 | hypothetical protein | - |
| DZQ17_RS04330 (DZQ17_04330) | - | 842001..843896 (+) | 1896 | WP_011284841.1 | gp58-like family protein | - |
| DZQ17_RS04335 (DZQ17_04335) | - | 843910..844071 (+) | 162 | WP_002988795.1 | hypothetical protein | - |
| DZQ17_RS04340 (DZQ17_04340) | - | 844074..844691 (+) | 618 | WP_011284840.1 | hypothetical protein | - |
| DZQ17_RS04345 (DZQ17_04345) | - | 844702..844998 (+) | 297 | WP_002990012.1 | hypothetical protein | - |
| DZQ17_RS04350 (DZQ17_04350) | - | 844995..845180 (+) | 186 | WP_011284839.1 | holin | - |
| DZQ17_RS04355 (DZQ17_04355) | - | 845292..846626 (+) | 1335 | WP_011284838.1 | GH25 family lysozyme | - |
| DZQ17_RS04360 (DZQ17_04360) | speC | 846702..847409 (-) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| DZQ17_RS04365 (DZQ17_04365) | mf2 | 847520..848278 (-) | 759 | WP_002985324.1 | DNase Mf2 | - |
| DZQ17_RS04370 (DZQ17_04370) | prx | 848518..848706 (+) | 189 | WP_002993136.1 | hypothetical protein | Regulator |
| DZQ17_RS04380 (DZQ17_04380) | - | 849297..849911 (+) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| DZQ17_RS04385 (DZQ17_04385) | - | 850038..850823 (-) | 786 | WP_002984433.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7239.28 Da Isoelectric Point: 3.9944
>NTDB_id=308796 DZQ17_RS04370 WP_002993136.1 848518..848706(+) (prx) [Streptococcus pyogenes strain MGAS28078]
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=308796 DZQ17_RS04370 WP_002993136.1 848518..848706(+) (prx) [Streptococcus pyogenes strain MGAS28078]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85.484 |
100 |
0.855 |
| prx | Streptococcus pyogenes MGAS8232 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
79.31 |
93.548 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
95.238 |
67.742 |
0.645 |
| prx | Streptococcus pyogenes MGAS315 |
80.488 |
66.129 |
0.532 |