Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | DZR83_RS04315 | Genome accession | NZ_CP031630 |
| Coordinates | 838560..838748 (+) | Length | 62 a.a. |
| NCBI ID | WP_011285559.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS28271 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 800022..840865 | 838560..838748 | within | 0 |
Gene organization within MGE regions
Location: 800022..840865
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DZR83_RS04030 (DZR83_04025) | - | 800022..800642 (-) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
| DZR83_RS04035 (DZR83_04030) | - | 801005..802093 (-) | 1089 | WP_011054595.1 | site-specific integrase | - |
| DZR83_RS04040 (DZR83_04035) | - | 802214..803107 (-) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| DZR83_RS04045 (DZR83_04040) | - | 803143..803967 (-) | 825 | WP_011285584.1 | helix-turn-helix transcriptional regulator | - |
| DZR83_RS04050 (DZR83_04045) | - | 804324..804482 (+) | 159 | WP_011285583.1 | hypothetical protein | - |
| DZR83_RS04055 (DZR83_04050) | - | 804512..805111 (-) | 600 | WP_011284882.1 | hypothetical protein | - |
| DZR83_RS04060 (DZR83_04055) | - | 805165..805374 (+) | 210 | WP_011284881.1 | hypothetical protein | - |
| DZR83_RS04065 (DZR83_04060) | - | 805363..805749 (-) | 387 | WP_011054589.1 | hypothetical protein | - |
| DZR83_RS04070 (DZR83_04065) | - | 805823..806023 (+) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| DZR83_RS04075 (DZR83_04070) | - | 806133..806342 (-) | 210 | WP_011017885.1 | hypothetical protein | - |
| DZR83_RS04080 (DZR83_04075) | - | 806473..806841 (-) | 369 | WP_015055958.1 | hypothetical protein | - |
| DZR83_RS09470 (DZR83_04080) | - | 806946..807134 (+) | 189 | Protein_735 | XRE family transcriptional regulator | - |
| DZR83_RS04090 (DZR83_04085) | - | 807148..807978 (+) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| DZR83_RS04095 (DZR83_04090) | - | 807965..808747 (+) | 783 | WP_011285581.1 | ATP-binding protein | - |
| DZR83_RS04100 (DZR83_04095) | - | 808888..809241 (+) | 354 | WP_011285579.1 | hypothetical protein | - |
| DZR83_RS04105 (DZR83_04100) | - | 809222..809476 (+) | 255 | WP_011285578.1 | hypothetical protein | - |
| DZR83_RS04110 (DZR83_04105) | - | 809498..809980 (+) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| DZR83_RS04115 (DZR83_04110) | - | 809981..810655 (+) | 675 | WP_111713462.1 | ERF family protein | - |
| DZR83_RS04120 (DZR83_04115) | ssb | 810648..811073 (+) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| DZR83_RS04125 (DZR83_04120) | - | 811079..811282 (+) | 204 | WP_011106686.1 | hypothetical protein | - |
| DZR83_RS04130 (DZR83_04125) | - | 811282..811722 (+) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| DZR83_RS04135 (DZR83_04130) | - | 811719..812075 (+) | 357 | WP_011284873.1 | hypothetical protein | - |
| DZR83_RS09575 (DZR83_04135) | - | 812072..812317 (+) | 246 | WP_011285573.1 | hypothetical protein | - |
| DZR83_RS04145 (DZR83_04140) | - | 812317..812553 (+) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| DZR83_RS09330 | - | 812550..812720 (+) | 171 | WP_002995952.1 | hypothetical protein | - |
| DZR83_RS04150 (DZR83_04145) | - | 812717..813001 (+) | 285 | WP_011018134.1 | hypothetical protein | - |
| DZR83_RS04155 (DZR83_04150) | - | 813003..813635 (+) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| DZR83_RS04160 (DZR83_04155) | - | 813638..814162 (+) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| DZR83_RS04165 (DZR83_04160) | - | 814159..814425 (+) | 267 | WP_011018131.1 | hypothetical protein | - |
| DZR83_RS04170 (DZR83_04165) | - | 814711..815145 (+) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DZR83_RS04175 (DZR83_04170) | - | 815755..816135 (+) | 381 | WP_011285571.1 | hypothetical protein | - |
| DZR83_RS04180 (DZR83_04175) | - | 816125..817399 (+) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| DZR83_RS04185 (DZR83_04180) | - | 817399..818724 (+) | 1326 | WP_011285570.1 | phage portal protein | - |
| DZR83_RS04190 (DZR83_04185) | - | 818693..819601 (+) | 909 | WP_011285569.1 | minor capsid protein | - |
| DZR83_RS04195 (DZR83_04190) | - | 819608..819877 (+) | 270 | WP_011285568.1 | hypothetical protein | - |
| DZR83_RS09475 | - | 819879..820013 (+) | 135 | WP_015055956.1 | hypothetical protein | - |
| DZR83_RS04200 (DZR83_04195) | - | 820122..820691 (+) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| DZR83_RS04205 (DZR83_04200) | - | 820710..821600 (+) | 891 | WP_009880261.1 | hypothetical protein | - |
| DZR83_RS04210 (DZR83_04205) | - | 821613..821906 (+) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| DZR83_RS04215 (DZR83_04210) | - | 821920..822264 (+) | 345 | WP_009880259.1 | hypothetical protein | - |
| DZR83_RS04220 (DZR83_04215) | - | 822261..822572 (+) | 312 | WP_011285567.1 | hypothetical protein | - |
| DZR83_RS04225 (DZR83_04220) | - | 822569..822964 (+) | 396 | WP_009880257.1 | hypothetical protein | - |
| DZR83_RS04230 (DZR83_04225) | - | 822966..823376 (+) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| DZR83_RS04235 (DZR83_04230) | - | 823388..823894 (+) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| DZR83_RS04240 (DZR83_04235) | - | 823907..824224 (+) | 318 | WP_009880254.1 | hypothetical protein | - |
| DZR83_RS04245 (DZR83_04240) | - | 824197..824655 (+) | 459 | WP_009880253.1 | hypothetical protein | - |
| DZR83_RS04250 (DZR83_04245) | - | 824648..826453 (+) | 1806 | WP_011054802.1 | tail protein | - |
| DZR83_RS04255 (DZR83_04250) | - | 826454..827938 (+) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| DZR83_RS04260 (DZR83_04255) | - | 827939..831379 (+) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| DZR83_RS04265 (DZR83_04260) | - | 831384..833246 (+) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| DZR83_RS04270 (DZR83_04265) | - | 833257..833604 (+) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| DZR83_RS09480 | - | 833618..833740 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| DZR83_RS04275 (DZR83_04270) | - | 833754..834077 (+) | 324 | WP_015055952.1 | hypothetical protein | - |
| DZR83_RS04280 (DZR83_04275) | - | 834077..834409 (+) | 333 | WP_011285562.1 | phage holin | - |
| DZR83_RS04285 (DZR83_04280) | - | 834411..835175 (+) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| DZR83_RS04290 (DZR83_04285) | - | 835187..835789 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| DZR83_RS04295 (DZR83_04290) | - | 835800..836573 (+) | 774 | WP_011054795.1 | hypothetical protein | - |
| DZR83_RS04300 (DZR83_04295) | - | 836583..836804 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| DZR83_RS04305 (DZR83_04300) | - | 836804..837463 (+) | 660 | WP_009880240.1 | hypothetical protein | - |
| DZR83_RS04310 (DZR83_04305) | speA | 837585..838340 (-) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| DZR83_RS04315 (DZR83_04310) | prx | 838560..838748 (+) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| DZR83_RS04325 (DZR83_04320) | - | 839339..839953 (+) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| DZR83_RS04330 (DZR83_04325) | - | 840080..840865 (-) | 786 | WP_002984433.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7290.41 Da Isoelectric Point: 4.3313
>NTDB_id=308689 DZR83_RS04315 WP_011285559.1 838560..838748(+) (prx) [Streptococcus pyogenes strain MGAS28271]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=308689 DZR83_RS04315 WP_011285559.1 838560..838748(+) (prx) [Streptococcus pyogenes strain MGAS28271]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
95.161 |
0.952 |
| prx | Streptococcus pyogenes MGAS315 |
79.032 |
100 |
0.79 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |