Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DZS66_RS07430 | Genome accession | NZ_CP031627 |
| Coordinates | 1467272..1467454 (-) | Length | 60 a.a. |
| NCBI ID | WP_011054856.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS28360 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1466477..1519731 | 1467272..1467454 | within | 0 |
Gene organization within MGE regions
Location: 1466477..1519731
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DZS66_RS07420 (DZS66_07410) | - | 1466477..1466713 (-) | 237 | WP_021340747.1 | DUF2829 domain-containing protein | - |
| DZS66_RS07430 (DZS66_07420) | prx | 1467272..1467454 (-) | 183 | WP_011054856.1 | hypothetical protein | Regulator |
| DZS66_RS07435 (DZS66_07425) | - | 1467687..1468673 (+) | 987 | WP_011106647.1 | DNA/RNA non-specific endonuclease | - |
| DZS66_RS07440 (DZS66_07430) | - | 1468787..1469302 (-) | 516 | WP_023077389.1 | hypothetical protein | - |
| DZS66_RS07445 (DZS66_07435) | - | 1469624..1470826 (-) | 1203 | WP_011184057.1 | glucosaminidase domain-containing protein | - |
| DZS66_RS07450 (DZS66_07440) | - | 1470942..1471169 (-) | 228 | WP_003058873.1 | phage holin | - |
| DZS66_RS07455 (DZS66_07445) | - | 1471166..1471438 (-) | 273 | WP_002986916.1 | hypothetical protein | - |
| DZS66_RS07460 (DZS66_07450) | - | 1471448..1472065 (-) | 618 | WP_011184056.1 | DUF1366 domain-containing protein | - |
| DZS66_RS07465 (DZS66_07455) | - | 1472062..1472499 (-) | 438 | WP_011106643.1 | DUF1617 family protein | - |
| DZS66_RS07470 (DZS66_07460) | - | 1472511..1474400 (-) | 1890 | WP_129851217.1 | gp58-like family protein | - |
| DZS66_RS07475 (DZS66_07465) | - | 1474411..1474725 (-) | 315 | WP_021340983.1 | hypothetical protein | - |
| DZS66_RS07480 (DZS66_07470) | - | 1474727..1475941 (-) | 1215 | WP_011284843.1 | hypothetical protein | - |
| DZS66_RS07485 (DZS66_07475) | - | 1475938..1477920 (-) | 1983 | WP_129851218.1 | phage tail protein | - |
| DZS66_RS07490 (DZS66_07480) | - | 1477930..1478772 (-) | 843 | WP_011054865.1 | phage tail family protein | - |
| DZS66_RS07495 (DZS66_07485) | - | 1478784..1483166 (-) | 4383 | WP_011054866.1 | tape measure protein | - |
| DZS66_RS07500 (DZS66_07490) | - | 1483181..1483414 (-) | 234 | WP_011054867.1 | hypothetical protein | - |
| DZS66_RS07505 (DZS66_07495) | - | 1483489..1483944 (-) | 456 | WP_011054868.1 | tail assembly chaperone | - |
| DZS66_RS07510 (DZS66_07500) | - | 1483998..1484597 (-) | 600 | WP_011054869.1 | phage major tail protein, TP901-1 family | - |
| DZS66_RS07515 (DZS66_07505) | - | 1484609..1484968 (-) | 360 | WP_129851219.1 | hypothetical protein | - |
| DZS66_RS07520 (DZS66_07510) | - | 1484972..1485316 (-) | 345 | WP_011106640.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DZS66_RS07525 (DZS66_07515) | - | 1485313..1485591 (-) | 279 | WP_011054872.1 | hypothetical protein | - |
| DZS66_RS07530 (DZS66_07520) | - | 1485602..1485958 (-) | 357 | WP_011054873.1 | phage head-tail connector protein | - |
| DZS66_RS07535 (DZS66_07525) | - | 1485970..1486857 (-) | 888 | WP_002983429.1 | hypothetical protein | - |
| DZS66_RS07540 (DZS66_07530) | - | 1486870..1487439 (-) | 570 | WP_011054874.1 | DUF4355 domain-containing protein | - |
| DZS66_RS07545 (DZS66_07535) | - | 1487607..1487873 (-) | 267 | WP_011054875.1 | hypothetical protein | - |
| DZS66_RS07550 (DZS66_07540) | - | 1487878..1488066 (-) | 189 | WP_011054876.1 | hypothetical protein | - |
| DZS66_RS07555 (DZS66_07545) | - | 1488094..1489542 (-) | 1449 | WP_011054877.1 | minor capsid protein | - |
| DZS66_RS07560 (DZS66_07550) | - | 1489502..1491034 (-) | 1533 | WP_011106638.1 | phage portal protein | - |
| DZS66_RS07565 (DZS66_07555) | - | 1491050..1492327 (-) | 1278 | WP_011054879.1 | PBSX family phage terminase large subunit | - |
| DZS66_RS07570 (DZS66_07560) | - | 1492317..1492769 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| DZS66_RS07575 (DZS66_07565) | - | 1492859..1493275 (-) | 417 | WP_011054881.1 | transcriptional regulator | - |
| DZS66_RS07580 (DZS66_07570) | - | 1493408..1493680 (-) | 273 | WP_011054882.1 | hypothetical protein | - |
| DZS66_RS09715 | - | 1493673..1493843 (-) | 171 | WP_011054883.1 | hypothetical protein | - |
| DZS66_RS07585 (DZS66_07575) | - | 1493844..1495166 (-) | 1323 | WP_011054884.1 | SNF2-related protein | - |
| DZS66_RS07590 (DZS66_07580) | - | 1495163..1495438 (-) | 276 | WP_011054885.1 | VRR-NUC domain-containing protein | - |
| DZS66_RS07595 (DZS66_07585) | - | 1495804..1498188 (-) | 2385 | WP_011054886.1 | phage/plasmid primase, P4 family | - |
| DZS66_RS07600 (DZS66_07590) | - | 1498193..1500115 (-) | 1923 | WP_011054887.1 | DNA polymerase | - |
| DZS66_RS07605 (DZS66_07595) | - | 1500158..1500721 (-) | 564 | WP_011054888.1 | DUF2815 family protein | - |
| DZS66_RS07610 (DZS66_07600) | - | 1500735..1501892 (-) | 1158 | WP_011054889.1 | DUF2800 domain-containing protein | - |
| DZS66_RS07615 (DZS66_07605) | - | 1501892..1502191 (-) | 300 | WP_000573833.1 | hypothetical protein | - |
| DZS66_RS07620 (DZS66_07610) | - | 1502279..1502482 (-) | 204 | WP_011054890.1 | hypothetical protein | - |
| DZS66_RS07625 (DZS66_07615) | - | 1502627..1503010 (-) | 384 | WP_011054892.1 | hypothetical protein | - |
| DZS66_RS07630 (DZS66_07620) | - | 1503007..1503214 (-) | 208 | Protein_1420 | hypothetical protein | - |
| DZS66_RS07635 (DZS66_07625) | - | 1503207..1503377 (-) | 171 | WP_011054894.1 | hypothetical protein | - |
| DZS66_RS07640 (DZS66_07630) | - | 1503406..1503663 (-) | 258 | WP_011054895.1 | hypothetical protein | - |
| DZS66_RS07645 (DZS66_07635) | - | 1503751..1503951 (-) | 201 | WP_011184050.1 | hypothetical protein | - |
| DZS66_RS07650 (DZS66_07640) | - | 1504002..1504193 (-) | 192 | WP_001283052.1 | hypothetical protein | - |
| DZS66_RS07655 (DZS66_07645) | - | 1504832..1505182 (+) | 351 | WP_011184049.1 | helix-turn-helix transcriptional regulator | - |
| DZS66_RS07660 (DZS66_07650) | - | 1505196..1505579 (+) | 384 | WP_011054898.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DZS66_RS07665 (DZS66_07655) | - | 1505590..1506141 (+) | 552 | WP_011054899.1 | hypothetical protein | - |
| DZS66_RS07670 (DZS66_07660) | - | 1506317..1507405 (+) | 1089 | WP_011054900.1 | site-specific integrase | - |
| DZS66_RS07675 (DZS66_07665) | - | 1507774..1508355 (-) | 582 | WP_011284555.1 | hypothetical protein | - |
| DZS66_RS07680 (DZS66_07670) | - | 1508589..1508812 (-) | 224 | Protein_1430 | hypothetical protein | - |
| DZS66_RS09720 | - | 1509043..1509180 (+) | 138 | WP_021340726.1 | hypothetical protein | - |
| DZS66_RS07685 (DZS66_07675) | spej | 1509382..1510080 (+) | 699 | WP_011284554.1 | streptococcal pyrogenic exotoxin SpeJ | - |
| DZS66_RS07690 (DZS66_07680) | - | 1510348..1510848 (+) | 501 | WP_011284552.1 | hypothetical protein | - |
| DZS66_RS07700 (DZS66_07690) | - | 1511221..1511472 (-) | 252 | WP_021340750.1 | hypothetical protein | - |
| DZS66_RS07705 (DZS66_07695) | - | 1511725..1512198 (-) | 474 | WP_021340725.1 | hypothetical protein | - |
| DZS66_RS07710 (DZS66_07700) | - | 1512654..1513906 (+) | 1253 | Protein_1436 | ISL3 family transposase | - |
| DZS66_RS07715 (DZS66_07705) | - | 1514213..1514665 (-) | 453 | WP_021340731.1 | hypothetical protein | - |
| DZS66_RS07720 (DZS66_07710) | - | 1515122..1515874 (+) | 753 | WP_021340763.1 | ADP-ribosyltransferase | - |
| DZS66_RS07725 (DZS66_07715) | nrdE | 1516079..1518259 (-) | 2181 | WP_011054229.1 | class 1b ribonucleoside-diphosphate reductase subunit alpha | - |
| DZS66_RS07730 (DZS66_07720) | nrdI | 1518226..1518714 (-) | 489 | WP_011284545.1 | class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI | - |
| DZS66_RS07735 (DZS66_07725) | nrdF | 1518718..1519731 (-) | 1014 | WP_011284544.1 | class 1b ribonucleoside-diphosphate reductase subunit beta | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6927.67 Da Isoelectric Point: 3.9286
>NTDB_id=308541 DZS66_RS07430 WP_011054856.1 1467272..1467454(-) (prx) [Streptococcus pyogenes strain MGAS28360]
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEVVTYENVEEVLRELDK
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEVVTYENVEEVLRELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=308541 DZS66_RS07430 WP_011054856.1 1467272..1467454(-) (prx) [Streptococcus pyogenes strain MGAS28360]
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGCGACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCGAATGAAGAGGTAAGAAATGGGGAGGTTGTAACATACGAAAATGTGGAAGAAG
TGCTGAGGGAATTAGACAAATAA
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGCGACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCGAATGAAGAGGTAAGAAATGGGGAGGTTGTAACATACGAAAATGTGGAAGAAG
TGCTGAGGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |