Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DZU27_RS04705 | Genome accession | NZ_CP031625 |
| Coordinates | 889116..889304 (+) | Length | 62 a.a. |
| NCBI ID | WP_002993136.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS28533 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 842362..891421 | 889116..889304 | within | 0 |
Gene organization within MGE regions
Location: 842362..891421
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DZU27_RS04360 (DZU27_04360) | - | 842362..842982 (-) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
| DZU27_RS04365 (DZU27_04365) | - | 843345..844433 (-) | 1089 | WP_023079773.1 | site-specific integrase | - |
| DZU27_RS04370 (DZU27_04370) | - | 844683..845492 (-) | 810 | WP_002984270.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| DZU27_RS04375 (DZU27_04375) | - | 845505..846248 (-) | 744 | WP_011284884.1 | S24 family peptidase | - |
| DZU27_RS09750 | - | 846606..846755 (+) | 150 | WP_021340643.1 | hypothetical protein | - |
| DZU27_RS04380 (DZU27_04380) | - | 846741..846956 (-) | 216 | WP_021341080.1 | hypothetical protein | - |
| DZU27_RS04385 (DZU27_04385) | - | 847015..847173 (+) | 159 | WP_011284883.1 | hypothetical protein | - |
| DZU27_RS04390 (DZU27_04390) | - | 847203..847802 (-) | 600 | WP_011284882.1 | hypothetical protein | - |
| DZU27_RS04395 (DZU27_04395) | - | 847856..848065 (+) | 210 | WP_011284881.1 | hypothetical protein | - |
| DZU27_RS04400 (DZU27_04400) | - | 848054..848440 (-) | 387 | WP_011054589.1 | hypothetical protein | - |
| DZU27_RS04405 (DZU27_04405) | - | 848514..848741 (+) | 228 | WP_002984281.1 | hypothetical protein | - |
| DZU27_RS04410 (DZU27_04410) | - | 848849..849358 (-) | 510 | WP_011017884.1 | hypothetical protein | - |
| DZU27_RS04420 (DZU27_04420) | - | 849617..849826 (-) | 210 | WP_002984292.1 | hypothetical protein | - |
| DZU27_RS04425 (DZU27_04425) | - | 849976..850215 (-) | 240 | WP_011284879.1 | hypothetical protein | - |
| DZU27_RS04430 (DZU27_04430) | - | 850382..850567 (+) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| DZU27_RS04435 (DZU27_04435) | - | 850646..850942 (+) | 297 | WP_011017882.1 | MerR family transcriptional regulator | - |
| DZU27_RS04440 (DZU27_04440) | - | 850939..851076 (+) | 138 | WP_011017881.1 | hypothetical protein | - |
| DZU27_RS04445 (DZU27_04445) | - | 851157..851486 (+) | 330 | WP_011284878.1 | hypothetical protein | - |
| DZU27_RS04450 (DZU27_04450) | - | 851486..851680 (+) | 195 | WP_002984315.1 | hypothetical protein | - |
| DZU27_RS04455 (DZU27_04455) | - | 851677..851961 (+) | 285 | WP_011284877.1 | hypothetical protein | - |
| DZU27_RS04460 (DZU27_04460) | - | 851958..852641 (+) | 684 | WP_002984321.1 | AAA family ATPase | - |
| DZU27_RS04465 (DZU27_04465) | - | 852647..854080 (+) | 1434 | Protein_805 | DEAD/DEAH box helicase | - |
| DZU27_RS04470 (DZU27_04470) | - | 854085..854567 (+) | 483 | WP_002984328.1 | DUF669 domain-containing protein | - |
| DZU27_RS04475 (DZU27_04475) | - | 854585..856138 (+) | 1554 | WP_011284875.1 | hypothetical protein | - |
| DZU27_RS04480 (DZU27_04480) | - | 856407..857276 (+) | 870 | WP_014635521.1 | bifunctional DNA primase/polymerase | - |
| DZU27_RS04485 (DZU27_04485) | - | 857296..857580 (+) | 285 | WP_011284874.1 | VRR-NUC domain-containing protein | - |
| DZU27_RS04490 (DZU27_04490) | - | 857564..857920 (+) | 357 | WP_011284873.1 | hypothetical protein | - |
| DZU27_RS10015 (DZU27_04495) | - | 857917..858162 (+) | 246 | WP_011284872.1 | hypothetical protein | - |
| DZU27_RS04500 (DZU27_04500) | - | 858162..858398 (+) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| DZU27_RS09755 | - | 858395..858565 (+) | 171 | WP_002995952.1 | hypothetical protein | - |
| DZU27_RS04505 (DZU27_04505) | - | 858562..858846 (+) | 285 | WP_011284869.1 | hypothetical protein | - |
| DZU27_RS04510 (DZU27_04510) | - | 858848..859480 (+) | 633 | WP_011888685.1 | N-6 DNA methylase | - |
| DZU27_RS04515 (DZU27_04515) | - | 859485..859964 (+) | 480 | WP_011888686.1 | DUF1642 domain-containing protein | - |
| DZU27_RS04520 (DZU27_04520) | - | 860413..860847 (+) | 435 | WP_011284866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DZU27_RS04530 (DZU27_04530) | - | 861425..862339 (+) | 915 | WP_011284864.1 | hypothetical protein | - |
| DZU27_RS09760 | - | 862429..862662 (-) | 234 | WP_002995461.1 | hypothetical protein | - |
| DZU27_RS04540 (DZU27_04540) | - | 862957..863334 (-) | 378 | WP_002987543.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| DZU27_RS04545 (DZU27_04545) | - | 863386..863571 (-) | 186 | WP_001132273.1 | type II toxin-antitoxin system HicA family toxin | - |
| DZU27_RS04550 (DZU27_04550) | - | 863670..864101 (+) | 432 | WP_023079766.1 | terminase small subunit | - |
| DZU27_RS04555 (DZU27_04555) | - | 864079..865386 (+) | 1308 | WP_020833530.1 | PBSX family phage terminase large subunit | - |
| DZU27_RS04560 (DZU27_04560) | - | 865398..866900 (+) | 1503 | WP_002984369.1 | phage portal protein | - |
| DZU27_RS04565 (DZU27_04565) | - | 866881..868443 (+) | 1563 | WP_011284860.1 | phage head morphogenesis protein | - |
| DZU27_RS04570 (DZU27_04570) | - | 868447..868632 (+) | 186 | WP_002988389.1 | hypothetical protein | - |
| DZU27_RS04575 (DZU27_04575) | - | 868702..869016 (+) | 315 | WP_011284859.1 | hypothetical protein | - |
| DZU27_RS04580 (DZU27_04580) | - | 869019..869285 (+) | 267 | WP_011284858.1 | hypothetical protein | - |
| DZU27_RS04585 (DZU27_04585) | - | 869429..869962 (+) | 534 | WP_023079765.1 | DUF4355 domain-containing protein | - |
| DZU27_RS04590 (DZU27_04590) | - | 869972..870352 (+) | 381 | WP_011284856.1 | head decoration protein | - |
| DZU27_RS04595 (DZU27_04595) | - | 870355..871437 (+) | 1083 | WP_011284855.1 | major capsid protein | - |
| DZU27_RS04600 (DZU27_04600) | - | 871447..871689 (+) | 243 | WP_011284854.1 | HeH/LEM domain-containing protein | - |
| DZU27_RS04605 (DZU27_04605) | - | 871703..872056 (+) | 354 | WP_002984392.1 | phage head-tail connector protein | - |
| DZU27_RS04610 (DZU27_04610) | - | 872053..872361 (+) | 309 | WP_011284852.1 | hypothetical protein | - |
| DZU27_RS04615 (DZU27_04615) | - | 872342..872707 (+) | 366 | WP_030126607.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DZU27_RS04620 (DZU27_04620) | - | 872704..873093 (+) | 390 | WP_011284850.1 | hypothetical protein | - |
| DZU27_RS04625 (DZU27_04625) | - | 873148..873771 (+) | 624 | WP_030126608.1 | phage major tail protein, TP901-1 family | - |
| DZU27_RS04630 (DZU27_04630) | - | 873825..874178 (+) | 354 | WP_002990023.1 | tail assembly chaperone | - |
| DZU27_RS04635 (DZU27_04635) | - | 874253..874549 (+) | 297 | WP_021340179.1 | hypothetical protein | - |
| DZU27_RS04640 (DZU27_04640) | - | 874564..878199 (+) | 3636 | WP_011284846.1 | tape measure protein | - |
| DZU27_RS04645 (DZU27_04645) | - | 878231..879010 (+) | 780 | WP_011284845.1 | distal tail protein Dit | - |
| DZU27_RS04650 (DZU27_04650) | - | 879007..881061 (+) | 2055 | WP_011284844.1 | phage tail spike protein | - |
| DZU27_RS04655 (DZU27_04655) | - | 881058..882272 (+) | 1215 | WP_011284843.1 | hypothetical protein | - |
| DZU27_RS04660 (DZU27_04660) | - | 882274..882588 (+) | 315 | WP_021340983.1 | hypothetical protein | - |
| DZU27_RS04665 (DZU27_04665) | - | 882599..884494 (+) | 1896 | WP_011284841.1 | gp58-like family protein | - |
| DZU27_RS04670 (DZU27_04670) | - | 884508..884669 (+) | 162 | WP_002988795.1 | hypothetical protein | - |
| DZU27_RS04675 (DZU27_04675) | - | 884672..885289 (+) | 618 | WP_011284840.1 | hypothetical protein | - |
| DZU27_RS04680 (DZU27_04680) | - | 885300..885596 (+) | 297 | WP_002990012.1 | hypothetical protein | - |
| DZU27_RS04685 (DZU27_04685) | - | 885593..885778 (+) | 186 | WP_011284839.1 | holin | - |
| DZU27_RS04690 (DZU27_04690) | - | 885890..887224 (+) | 1335 | WP_011284838.1 | GH25 family lysozyme | - |
| DZU27_RS04695 (DZU27_04695) | speC | 887300..888007 (-) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| DZU27_RS04700 (DZU27_04700) | mf2 | 888118..888876 (-) | 759 | WP_011184727.1 | DNase Mf2 | - |
| DZU27_RS04705 (DZU27_04705) | prx | 889116..889304 (+) | 189 | WP_002993136.1 | hypothetical protein | Regulator |
| DZU27_RS04715 (DZU27_04715) | - | 889895..890509 (+) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| DZU27_RS04720 (DZU27_04720) | - | 890636..891421 (-) | 786 | WP_002984433.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7239.28 Da Isoelectric Point: 3.9944
>NTDB_id=308423 DZU27_RS04705 WP_002993136.1 889116..889304(+) (prx) [Streptococcus pyogenes strain MGAS28533]
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=308423 DZU27_RS04705 WP_002993136.1 889116..889304(+) (prx) [Streptococcus pyogenes strain MGAS28533]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85.484 |
100 |
0.855 |
| prx | Streptococcus pyogenes MGAS8232 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
79.31 |
93.548 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
95.238 |
67.742 |
0.645 |
| prx | Streptococcus pyogenes MGAS315 |
80.488 |
66.129 |
0.532 |