Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DZV55_RS04490 | Genome accession | NZ_CP031623 |
| Coordinates | 860424..860612 (+) | Length | 62 a.a. |
| NCBI ID | WP_002993136.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS28669 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 813670..868196 | 860424..860612 | within | 0 |
Gene organization within MGE regions
Location: 813670..868196
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DZV55_RS04145 (DZV55_04150) | - | 813670..814290 (-) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
| DZV55_RS04150 (DZV55_04155) | - | 814653..815741 (-) | 1089 | WP_023079773.1 | site-specific integrase | - |
| DZV55_RS04155 (DZV55_04160) | - | 815991..816800 (-) | 810 | WP_002984270.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| DZV55_RS04160 (DZV55_04165) | - | 816813..817556 (-) | 744 | WP_011284884.1 | S24 family peptidase | - |
| DZV55_RS09780 | - | 817914..818063 (+) | 150 | WP_021340643.1 | hypothetical protein | - |
| DZV55_RS04165 (DZV55_04170) | - | 818049..818264 (-) | 216 | WP_021341080.1 | hypothetical protein | - |
| DZV55_RS04170 (DZV55_04175) | - | 818323..818481 (+) | 159 | WP_011284883.1 | hypothetical protein | - |
| DZV55_RS04175 (DZV55_04180) | - | 818511..819110 (-) | 600 | WP_011284882.1 | hypothetical protein | - |
| DZV55_RS04180 (DZV55_04185) | - | 819164..819373 (+) | 210 | WP_011284881.1 | hypothetical protein | - |
| DZV55_RS04185 (DZV55_04190) | - | 819362..819748 (-) | 387 | WP_011054589.1 | hypothetical protein | - |
| DZV55_RS04190 (DZV55_04195) | - | 819822..820049 (+) | 228 | WP_002984281.1 | hypothetical protein | - |
| DZV55_RS04195 (DZV55_04200) | - | 820157..820666 (-) | 510 | WP_011017884.1 | hypothetical protein | - |
| DZV55_RS04205 (DZV55_04210) | - | 820925..821134 (-) | 210 | WP_002984292.1 | hypothetical protein | - |
| DZV55_RS04210 (DZV55_04215) | - | 821284..821523 (-) | 240 | WP_011284879.1 | hypothetical protein | - |
| DZV55_RS04215 (DZV55_04220) | - | 821690..821875 (+) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| DZV55_RS04220 (DZV55_04225) | - | 821954..822250 (+) | 297 | WP_011017882.1 | MerR family transcriptional regulator | - |
| DZV55_RS04225 (DZV55_04230) | - | 822247..822384 (+) | 138 | WP_011017881.1 | hypothetical protein | - |
| DZV55_RS04230 (DZV55_04235) | - | 822465..822794 (+) | 330 | WP_011284878.1 | hypothetical protein | - |
| DZV55_RS04235 (DZV55_04240) | - | 822794..822988 (+) | 195 | WP_002984315.1 | hypothetical protein | - |
| DZV55_RS04240 (DZV55_04245) | - | 822985..823269 (+) | 285 | WP_011284877.1 | hypothetical protein | - |
| DZV55_RS04245 (DZV55_04250) | - | 823266..823949 (+) | 684 | WP_002984321.1 | AAA family ATPase | - |
| DZV55_RS04250 (DZV55_04255) | - | 823955..825388 (+) | 1434 | Protein_764 | DEAD/DEAH box helicase | - |
| DZV55_RS04255 (DZV55_04260) | - | 825393..825875 (+) | 483 | WP_002984328.1 | DUF669 domain-containing protein | - |
| DZV55_RS04260 (DZV55_04265) | - | 825893..827446 (+) | 1554 | WP_011284875.1 | hypothetical protein | - |
| DZV55_RS04265 (DZV55_04270) | - | 827715..828584 (+) | 870 | WP_014635521.1 | bifunctional DNA primase/polymerase | - |
| DZV55_RS04270 (DZV55_04275) | - | 828604..828888 (+) | 285 | WP_011284874.1 | VRR-NUC domain-containing protein | - |
| DZV55_RS04275 (DZV55_04280) | - | 828872..829228 (+) | 357 | WP_011284873.1 | hypothetical protein | - |
| DZV55_RS10090 (DZV55_04285) | - | 829225..829470 (+) | 246 | WP_011284872.1 | hypothetical protein | - |
| DZV55_RS04285 (DZV55_04290) | - | 829470..829706 (+) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| DZV55_RS09785 | - | 829703..829873 (+) | 171 | WP_002995952.1 | hypothetical protein | - |
| DZV55_RS04290 (DZV55_04295) | - | 829870..830154 (+) | 285 | WP_011284869.1 | hypothetical protein | - |
| DZV55_RS04295 (DZV55_04300) | - | 830156..830788 (+) | 633 | WP_011888685.1 | N-6 DNA methylase | - |
| DZV55_RS04300 (DZV55_04305) | - | 830793..831272 (+) | 480 | WP_011888686.1 | DUF1642 domain-containing protein | - |
| DZV55_RS04305 (DZV55_04310) | - | 831721..832155 (+) | 435 | WP_011284866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DZV55_RS04315 (DZV55_04320) | - | 832733..833647 (+) | 915 | WP_011284864.1 | hypothetical protein | - |
| DZV55_RS09790 | - | 833737..833970 (-) | 234 | WP_002995461.1 | hypothetical protein | - |
| DZV55_RS04325 (DZV55_04330) | - | 834265..834642 (-) | 378 | WP_002987543.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| DZV55_RS04330 (DZV55_04335) | - | 834694..834879 (-) | 186 | WP_001132273.1 | type II toxin-antitoxin system HicA family toxin | - |
| DZV55_RS04335 (DZV55_04340) | - | 834978..835409 (+) | 432 | WP_023079766.1 | terminase small subunit | - |
| DZV55_RS04340 (DZV55_04345) | - | 835387..836694 (+) | 1308 | WP_020833530.1 | PBSX family phage terminase large subunit | - |
| DZV55_RS04345 (DZV55_04350) | - | 836706..838208 (+) | 1503 | WP_002984369.1 | phage portal protein | - |
| DZV55_RS04350 (DZV55_04355) | - | 838189..839751 (+) | 1563 | WP_011284860.1 | phage head morphogenesis protein | - |
| DZV55_RS04355 (DZV55_04360) | - | 839755..839940 (+) | 186 | WP_002988389.1 | hypothetical protein | - |
| DZV55_RS04360 (DZV55_04365) | - | 840010..840324 (+) | 315 | WP_011284859.1 | hypothetical protein | - |
| DZV55_RS04365 (DZV55_04370) | - | 840327..840593 (+) | 267 | WP_011284858.1 | hypothetical protein | - |
| DZV55_RS04370 (DZV55_04375) | - | 840737..841270 (+) | 534 | WP_023079765.1 | DUF4355 domain-containing protein | - |
| DZV55_RS04375 (DZV55_04380) | - | 841280..841660 (+) | 381 | WP_011284856.1 | head decoration protein | - |
| DZV55_RS04380 (DZV55_04385) | - | 841663..842745 (+) | 1083 | WP_011284855.1 | major capsid protein | - |
| DZV55_RS04385 (DZV55_04390) | - | 842755..842997 (+) | 243 | WP_011284854.1 | HeH/LEM domain-containing protein | - |
| DZV55_RS04390 (DZV55_04395) | - | 843011..843364 (+) | 354 | WP_002984392.1 | phage head-tail connector protein | - |
| DZV55_RS04395 (DZV55_04400) | - | 843361..843669 (+) | 309 | WP_011284852.1 | hypothetical protein | - |
| DZV55_RS04400 (DZV55_04405) | - | 843650..844015 (+) | 366 | WP_129796146.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DZV55_RS04405 (DZV55_04410) | - | 844012..844401 (+) | 390 | WP_011284850.1 | hypothetical protein | - |
| DZV55_RS04410 (DZV55_04415) | - | 844456..845079 (+) | 624 | WP_030126608.1 | phage major tail protein, TP901-1 family | - |
| DZV55_RS04415 (DZV55_04420) | - | 845133..845486 (+) | 354 | WP_002990023.1 | tail assembly chaperone | - |
| DZV55_RS04420 (DZV55_04425) | - | 845561..845857 (+) | 297 | WP_021340179.1 | hypothetical protein | - |
| DZV55_RS04425 (DZV55_04430) | - | 845872..849507 (+) | 3636 | WP_011284846.1 | tape measure protein | - |
| DZV55_RS04430 (DZV55_04435) | - | 849539..850318 (+) | 780 | WP_011284845.1 | distal tail protein Dit | - |
| DZV55_RS04435 (DZV55_04440) | - | 850315..852369 (+) | 2055 | WP_011284844.1 | phage tail spike protein | - |
| DZV55_RS04440 (DZV55_04445) | - | 852366..853580 (+) | 1215 | WP_011284843.1 | hypothetical protein | - |
| DZV55_RS04445 (DZV55_04450) | - | 853582..853896 (+) | 315 | WP_021340983.1 | hypothetical protein | - |
| DZV55_RS04450 (DZV55_04455) | - | 853907..855802 (+) | 1896 | WP_011284841.1 | gp58-like family protein | - |
| DZV55_RS04455 (DZV55_04460) | - | 855816..855977 (+) | 162 | WP_002988795.1 | hypothetical protein | - |
| DZV55_RS04460 (DZV55_04465) | - | 855980..856597 (+) | 618 | WP_011284840.1 | hypothetical protein | - |
| DZV55_RS04465 (DZV55_04470) | - | 856608..856904 (+) | 297 | WP_002990012.1 | hypothetical protein | - |
| DZV55_RS04470 (DZV55_04475) | - | 856901..857086 (+) | 186 | WP_011284839.1 | holin | - |
| DZV55_RS04475 (DZV55_04480) | - | 857198..858532 (+) | 1335 | WP_011888923.1 | GH25 family lysozyme | - |
| DZV55_RS04480 (DZV55_04485) | speC | 858608..859315 (-) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| DZV55_RS04485 (DZV55_04490) | mf2 | 859426..860184 (-) | 759 | WP_011184727.1 | DNase Mf2 | - |
| DZV55_RS04490 (DZV55_04495) | prx | 860424..860612 (+) | 189 | WP_002993136.1 | hypothetical protein | Regulator |
| DZV55_RS04500 (DZV55_04505) | - | 861203..861817 (+) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| DZV55_RS04505 (DZV55_04510) | - | 861944..862729 (-) | 786 | WP_002984433.1 | hypothetical protein | - |
| DZV55_RS04510 (DZV55_04515) | - | 862739..863437 (-) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| DZV55_RS04515 (DZV55_04520) | - | 863437..863808 (-) | 372 | WP_002989617.1 | GntR family transcriptional regulator | - |
| DZV55_RS04520 (DZV55_04525) | - | 863993..867103 (+) | 3111 | WP_011284836.1 | DNA polymerase III subunit alpha | - |
| DZV55_RS04525 (DZV55_04530) | pfkA | 867183..868196 (+) | 1014 | WP_002984444.1 | 6-phosphofructokinase | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7239.28 Da Isoelectric Point: 3.9944
>NTDB_id=308316 DZV55_RS04490 WP_002993136.1 860424..860612(+) (prx) [Streptococcus pyogenes strain MGAS28669]
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=308316 DZV55_RS04490 WP_002993136.1 860424..860612(+) (prx) [Streptococcus pyogenes strain MGAS28669]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85.484 |
100 |
0.855 |
| prx | Streptococcus pyogenes MGAS8232 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
79.31 |
93.548 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
95.238 |
67.742 |
0.645 |
| prx | Streptococcus pyogenes MGAS315 |
80.488 |
66.129 |
0.532 |