Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DZV70_RS04710 | Genome accession | NZ_CP031622 |
| Coordinates | 890575..890763 (+) | Length | 62 a.a. |
| NCBI ID | WP_002993136.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS28686 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 843821..898347 | 890575..890763 | within | 0 |
Gene organization within MGE regions
Location: 843821..898347
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DZV70_RS04365 (DZV70_04365) | - | 843821..844441 (-) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
| DZV70_RS04370 (DZV70_04370) | - | 844804..845892 (-) | 1089 | WP_023079773.1 | site-specific integrase | - |
| DZV70_RS04375 (DZV70_04375) | - | 846142..846951 (-) | 810 | WP_002984270.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| DZV70_RS04380 (DZV70_04380) | - | 846964..847707 (-) | 744 | WP_011284884.1 | S24 family peptidase | - |
| DZV70_RS09750 | - | 848065..848214 (+) | 150 | WP_021340643.1 | hypothetical protein | - |
| DZV70_RS04385 (DZV70_04385) | - | 848200..848415 (-) | 216 | WP_021341080.1 | hypothetical protein | - |
| DZV70_RS04390 (DZV70_04390) | - | 848474..848632 (+) | 159 | WP_011284883.1 | hypothetical protein | - |
| DZV70_RS04395 (DZV70_04395) | - | 848662..849261 (-) | 600 | WP_011284882.1 | hypothetical protein | - |
| DZV70_RS04400 (DZV70_04400) | - | 849315..849524 (+) | 210 | WP_011284881.1 | hypothetical protein | - |
| DZV70_RS04405 (DZV70_04405) | - | 849513..849899 (-) | 387 | WP_011054589.1 | hypothetical protein | - |
| DZV70_RS04410 (DZV70_04410) | - | 849973..850200 (+) | 228 | WP_002984281.1 | hypothetical protein | - |
| DZV70_RS04415 (DZV70_04415) | - | 850308..850817 (-) | 510 | WP_011017884.1 | hypothetical protein | - |
| DZV70_RS04425 (DZV70_04425) | - | 851076..851285 (-) | 210 | WP_002984292.1 | hypothetical protein | - |
| DZV70_RS04430 (DZV70_04430) | - | 851435..851674 (-) | 240 | WP_011284879.1 | hypothetical protein | - |
| DZV70_RS04435 (DZV70_04435) | - | 851841..852026 (+) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| DZV70_RS04440 (DZV70_04440) | - | 852105..852401 (+) | 297 | WP_011017882.1 | MerR family transcriptional regulator | - |
| DZV70_RS04445 (DZV70_04445) | - | 852398..852535 (+) | 138 | WP_011017881.1 | hypothetical protein | - |
| DZV70_RS04450 (DZV70_04450) | - | 852616..852945 (+) | 330 | WP_011284878.1 | hypothetical protein | - |
| DZV70_RS04455 (DZV70_04455) | - | 852945..853139 (+) | 195 | WP_002984315.1 | hypothetical protein | - |
| DZV70_RS04460 (DZV70_04460) | - | 853136..853420 (+) | 285 | WP_011284877.1 | hypothetical protein | - |
| DZV70_RS04465 (DZV70_04465) | - | 853417..854100 (+) | 684 | WP_002984321.1 | AAA family ATPase | - |
| DZV70_RS04470 (DZV70_04470) | - | 854106..855539 (+) | 1434 | Protein_805 | DEAD/DEAH box helicase | - |
| DZV70_RS04475 (DZV70_04475) | - | 855544..856026 (+) | 483 | WP_002984328.1 | DUF669 domain-containing protein | - |
| DZV70_RS04480 (DZV70_04480) | - | 856044..857597 (+) | 1554 | WP_011284875.1 | hypothetical protein | - |
| DZV70_RS04485 (DZV70_04485) | - | 857866..858735 (+) | 870 | WP_014635521.1 | bifunctional DNA primase/polymerase | - |
| DZV70_RS04490 (DZV70_04490) | - | 858755..859039 (+) | 285 | WP_011284874.1 | VRR-NUC domain-containing protein | - |
| DZV70_RS04495 (DZV70_04495) | - | 859023..859379 (+) | 357 | WP_011284873.1 | hypothetical protein | - |
| DZV70_RS10020 (DZV70_04500) | - | 859376..859621 (+) | 246 | WP_011284872.1 | hypothetical protein | - |
| DZV70_RS04505 (DZV70_04505) | - | 859621..859857 (+) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| DZV70_RS09755 | - | 859854..860024 (+) | 171 | WP_002995952.1 | hypothetical protein | - |
| DZV70_RS04510 (DZV70_04510) | - | 860021..860305 (+) | 285 | WP_011284869.1 | hypothetical protein | - |
| DZV70_RS04515 (DZV70_04515) | - | 860307..860939 (+) | 633 | WP_011888685.1 | N-6 DNA methylase | - |
| DZV70_RS04520 (DZV70_04520) | - | 860944..861423 (+) | 480 | WP_011888686.1 | DUF1642 domain-containing protein | - |
| DZV70_RS09760 | - | 861420..861590 (+) | 171 | WP_002987493.1 | hypothetical protein | - |
| DZV70_RS04525 (DZV70_04525) | - | 861872..862306 (+) | 435 | WP_011284866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DZV70_RS04535 (DZV70_04535) | - | 862884..863798 (+) | 915 | WP_011284864.1 | hypothetical protein | - |
| DZV70_RS09765 | - | 863888..864121 (-) | 234 | WP_002995461.1 | hypothetical protein | - |
| DZV70_RS04545 (DZV70_04545) | - | 864416..864793 (-) | 378 | WP_002987543.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| DZV70_RS04550 (DZV70_04550) | - | 864845..865030 (-) | 186 | WP_001132273.1 | type II toxin-antitoxin system HicA family toxin | - |
| DZV70_RS04555 (DZV70_04555) | - | 865129..865560 (+) | 432 | WP_023079766.1 | terminase small subunit | - |
| DZV70_RS04560 (DZV70_04560) | - | 865538..866845 (+) | 1308 | WP_020833530.1 | PBSX family phage terminase large subunit | - |
| DZV70_RS04565 (DZV70_04565) | - | 866857..868359 (+) | 1503 | WP_002984369.1 | phage portal protein | - |
| DZV70_RS04570 (DZV70_04570) | - | 868340..869902 (+) | 1563 | WP_011284860.1 | phage head morphogenesis protein | - |
| DZV70_RS04575 (DZV70_04575) | - | 869906..870091 (+) | 186 | WP_002988389.1 | hypothetical protein | - |
| DZV70_RS04580 (DZV70_04580) | - | 870161..870475 (+) | 315 | WP_011284859.1 | hypothetical protein | - |
| DZV70_RS04585 (DZV70_04585) | - | 870478..870744 (+) | 267 | WP_011284858.1 | hypothetical protein | - |
| DZV70_RS04590 (DZV70_04590) | - | 870888..871421 (+) | 534 | WP_023079765.1 | DUF4355 domain-containing protein | - |
| DZV70_RS04595 (DZV70_04595) | - | 871431..871811 (+) | 381 | WP_011284856.1 | head decoration protein | - |
| DZV70_RS04600 (DZV70_04600) | - | 871814..872896 (+) | 1083 | WP_011284855.1 | major capsid protein | - |
| DZV70_RS04605 (DZV70_04605) | - | 872906..873148 (+) | 243 | WP_011284854.1 | HeH/LEM domain-containing protein | - |
| DZV70_RS04610 (DZV70_04610) | - | 873162..873515 (+) | 354 | WP_002984392.1 | phage head-tail connector protein | - |
| DZV70_RS04615 (DZV70_04615) | - | 873512..873820 (+) | 309 | WP_011284852.1 | hypothetical protein | - |
| DZV70_RS04620 (DZV70_04620) | - | 873801..874166 (+) | 366 | WP_030126607.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DZV70_RS04625 (DZV70_04625) | - | 874163..874552 (+) | 390 | WP_011284850.1 | hypothetical protein | - |
| DZV70_RS04630 (DZV70_04630) | - | 874607..875230 (+) | 624 | WP_030126608.1 | phage major tail protein, TP901-1 family | - |
| DZV70_RS04635 (DZV70_04635) | - | 875284..875637 (+) | 354 | WP_002990023.1 | tail assembly chaperone | - |
| DZV70_RS04640 (DZV70_04640) | - | 875712..876008 (+) | 297 | WP_021340179.1 | hypothetical protein | - |
| DZV70_RS04645 (DZV70_04645) | - | 876023..879658 (+) | 3636 | WP_011284846.1 | tape measure protein | - |
| DZV70_RS04650 (DZV70_04650) | - | 879690..880469 (+) | 780 | WP_011284845.1 | distal tail protein Dit | - |
| DZV70_RS04655 (DZV70_04655) | - | 880466..882520 (+) | 2055 | WP_011284844.1 | phage tail spike protein | - |
| DZV70_RS04660 (DZV70_04660) | - | 882517..883731 (+) | 1215 | WP_011284843.1 | hypothetical protein | - |
| DZV70_RS04665 (DZV70_04665) | - | 883733..884047 (+) | 315 | WP_021340983.1 | hypothetical protein | - |
| DZV70_RS04670 (DZV70_04670) | - | 884058..885953 (+) | 1896 | WP_011284841.1 | gp58-like family protein | - |
| DZV70_RS04675 (DZV70_04675) | - | 885967..886128 (+) | 162 | WP_002988795.1 | hypothetical protein | - |
| DZV70_RS04680 (DZV70_04680) | - | 886131..886748 (+) | 618 | WP_011284840.1 | hypothetical protein | - |
| DZV70_RS04685 (DZV70_04685) | - | 886759..887055 (+) | 297 | WP_002990012.1 | hypothetical protein | - |
| DZV70_RS04690 (DZV70_04690) | - | 887052..887237 (+) | 186 | WP_011284839.1 | holin | - |
| DZV70_RS04695 (DZV70_04695) | - | 887349..888683 (+) | 1335 | WP_011284838.1 | GH25 family lysozyme | - |
| DZV70_RS04700 (DZV70_04700) | speC | 888759..889466 (-) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| DZV70_RS04705 (DZV70_04705) | mf2 | 889577..890335 (-) | 759 | WP_011184727.1 | DNase Mf2 | - |
| DZV70_RS04710 (DZV70_04710) | prx | 890575..890763 (+) | 189 | WP_002993136.1 | hypothetical protein | Regulator |
| DZV70_RS04720 (DZV70_04720) | - | 891354..891968 (+) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| DZV70_RS04725 (DZV70_04725) | - | 892095..892880 (-) | 786 | WP_002984433.1 | hypothetical protein | - |
| DZV70_RS04730 (DZV70_04730) | - | 892890..893588 (-) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| DZV70_RS04735 (DZV70_04735) | - | 893588..893959 (-) | 372 | WP_002989617.1 | GntR family transcriptional regulator | - |
| DZV70_RS04740 (DZV70_04740) | - | 894144..897254 (+) | 3111 | WP_011284836.1 | DNA polymerase III subunit alpha | - |
| DZV70_RS04745 (DZV70_04745) | pfkA | 897334..898347 (+) | 1014 | WP_002984444.1 | 6-phosphofructokinase | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7239.28 Da Isoelectric Point: 3.9944
>NTDB_id=308263 DZV70_RS04710 WP_002993136.1 890575..890763(+) (prx) [Streptococcus pyogenes strain MGAS28686]
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=308263 DZV70_RS04710 WP_002993136.1 890575..890763(+) (prx) [Streptococcus pyogenes strain MGAS28686]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85.484 |
100 |
0.855 |
| prx | Streptococcus pyogenes MGAS8232 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
79.31 |
93.548 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
95.238 |
67.742 |
0.645 |
| prx | Streptococcus pyogenes MGAS315 |
80.488 |
66.129 |
0.532 |