Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DZ066_RS04985 | Genome accession | NZ_CP031619 |
| Coordinates | 932752..932940 (+) | Length | 62 a.a. |
| NCBI ID | WP_002993136.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS29284 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 885998..935057 | 932752..932940 | within | 0 |
Gene organization within MGE regions
Location: 885998..935057
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DZ066_RS04640 (DZ066_04640) | - | 885998..886618 (-) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
| DZ066_RS04645 (DZ066_04645) | - | 886981..888069 (-) | 1089 | WP_023079773.1 | site-specific integrase | - |
| DZ066_RS04650 (DZ066_04650) | - | 888319..889128 (-) | 810 | WP_023079768.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| DZ066_RS04655 (DZ066_04655) | - | 889141..889884 (-) | 744 | WP_011284884.1 | S24 family peptidase | - |
| DZ066_RS10100 | - | 890242..890391 (+) | 150 | WP_021340643.1 | hypothetical protein | - |
| DZ066_RS04660 (DZ066_04660) | - | 890377..890592 (-) | 216 | WP_021341080.1 | hypothetical protein | - |
| DZ066_RS04665 (DZ066_04665) | - | 890651..890809 (+) | 159 | WP_011284883.1 | hypothetical protein | - |
| DZ066_RS04670 (DZ066_04670) | - | 890839..891438 (-) | 600 | WP_011284882.1 | hypothetical protein | - |
| DZ066_RS04675 (DZ066_04675) | - | 891492..891701 (+) | 210 | WP_011284881.1 | hypothetical protein | - |
| DZ066_RS04680 (DZ066_04680) | - | 891690..892076 (-) | 387 | WP_011054589.1 | hypothetical protein | - |
| DZ066_RS04685 (DZ066_04685) | - | 892150..892377 (+) | 228 | WP_002984281.1 | hypothetical protein | - |
| DZ066_RS04690 (DZ066_04690) | - | 892485..892994 (-) | 510 | WP_011017884.1 | hypothetical protein | - |
| DZ066_RS04700 (DZ066_04700) | - | 893253..893462 (-) | 210 | WP_002984292.1 | hypothetical protein | - |
| DZ066_RS04705 (DZ066_04705) | - | 893612..893851 (-) | 240 | WP_011284879.1 | hypothetical protein | - |
| DZ066_RS04710 (DZ066_04710) | - | 894018..894203 (+) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| DZ066_RS04715 (DZ066_04715) | - | 894282..894578 (+) | 297 | WP_011017882.1 | MerR family transcriptional regulator | - |
| DZ066_RS04720 (DZ066_04720) | - | 894575..894712 (+) | 138 | WP_011017881.1 | hypothetical protein | - |
| DZ066_RS04725 (DZ066_04725) | - | 894793..895122 (+) | 330 | WP_011284878.1 | hypothetical protein | - |
| DZ066_RS04730 (DZ066_04730) | - | 895122..895316 (+) | 195 | WP_002984315.1 | hypothetical protein | - |
| DZ066_RS04735 (DZ066_04735) | - | 895313..895597 (+) | 285 | WP_011284877.1 | hypothetical protein | - |
| DZ066_RS04740 (DZ066_04740) | - | 895594..896277 (+) | 684 | WP_002984321.1 | AAA family ATPase | - |
| DZ066_RS04745 (DZ066_04745) | - | 896283..897716 (+) | 1434 | Protein_863 | DEAD/DEAH box helicase | - |
| DZ066_RS04750 (DZ066_04750) | - | 897721..898203 (+) | 483 | WP_002984328.1 | DUF669 domain-containing protein | - |
| DZ066_RS04755 (DZ066_04755) | - | 898221..899774 (+) | 1554 | WP_011284875.1 | hypothetical protein | - |
| DZ066_RS04760 (DZ066_04760) | - | 900043..900912 (+) | 870 | WP_014635521.1 | bifunctional DNA primase/polymerase | - |
| DZ066_RS04765 (DZ066_04765) | - | 900932..901216 (+) | 285 | WP_011284874.1 | VRR-NUC domain-containing protein | - |
| DZ066_RS04770 (DZ066_04770) | - | 901200..901556 (+) | 357 | WP_011284873.1 | hypothetical protein | - |
| DZ066_RS10370 (DZ066_04775) | - | 901553..901798 (+) | 246 | WP_011284872.1 | hypothetical protein | - |
| DZ066_RS04780 (DZ066_04780) | - | 901798..902034 (+) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| DZ066_RS10105 | - | 902031..902201 (+) | 171 | WP_002995952.1 | hypothetical protein | - |
| DZ066_RS04785 (DZ066_04785) | - | 902198..902482 (+) | 285 | WP_011284869.1 | hypothetical protein | - |
| DZ066_RS04790 (DZ066_04790) | - | 902484..903116 (+) | 633 | WP_011888685.1 | N-6 DNA methylase | - |
| DZ066_RS04795 (DZ066_04795) | - | 903121..903600 (+) | 480 | WP_011888686.1 | DUF1642 domain-containing protein | - |
| DZ066_RS10110 | - | 903597..903767 (+) | 171 | WP_002987493.1 | hypothetical protein | - |
| DZ066_RS04800 (DZ066_04800) | - | 904049..904483 (+) | 435 | WP_011284866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DZ066_RS04810 (DZ066_04810) | - | 905061..905975 (+) | 915 | WP_011284864.1 | hypothetical protein | - |
| DZ066_RS10115 | - | 906065..906298 (-) | 234 | WP_002995461.1 | hypothetical protein | - |
| DZ066_RS04820 (DZ066_04820) | - | 906593..906970 (-) | 378 | WP_002987543.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| DZ066_RS04825 (DZ066_04825) | - | 907022..907207 (-) | 186 | WP_001132273.1 | type II toxin-antitoxin system HicA family toxin | - |
| DZ066_RS04830 (DZ066_04830) | - | 907306..907737 (+) | 432 | WP_023079766.1 | terminase small subunit | - |
| DZ066_RS04835 (DZ066_04835) | - | 907715..909022 (+) | 1308 | WP_020833530.1 | PBSX family phage terminase large subunit | - |
| DZ066_RS04840 (DZ066_04840) | - | 909034..910536 (+) | 1503 | WP_002984369.1 | phage portal protein | - |
| DZ066_RS04845 (DZ066_04845) | - | 910517..912079 (+) | 1563 | WP_011284860.1 | phage head morphogenesis protein | - |
| DZ066_RS04850 (DZ066_04850) | - | 912083..912268 (+) | 186 | WP_002988389.1 | hypothetical protein | - |
| DZ066_RS04855 (DZ066_04855) | - | 912338..912652 (+) | 315 | WP_011284859.1 | hypothetical protein | - |
| DZ066_RS04860 (DZ066_04860) | - | 912655..912921 (+) | 267 | WP_011284858.1 | hypothetical protein | - |
| DZ066_RS04865 (DZ066_04865) | - | 913065..913598 (+) | 534 | WP_023079765.1 | DUF4355 domain-containing protein | - |
| DZ066_RS04870 (DZ066_04870) | - | 913608..913988 (+) | 381 | WP_011284856.1 | head decoration protein | - |
| DZ066_RS04875 (DZ066_04875) | - | 913991..915073 (+) | 1083 | WP_011284855.1 | major capsid protein | - |
| DZ066_RS04880 (DZ066_04880) | - | 915083..915325 (+) | 243 | WP_011284854.1 | HeH/LEM domain-containing protein | - |
| DZ066_RS04885 (DZ066_04885) | - | 915339..915692 (+) | 354 | WP_002984392.1 | phage head-tail connector protein | - |
| DZ066_RS04890 (DZ066_04890) | - | 915689..915997 (+) | 309 | WP_011284852.1 | hypothetical protein | - |
| DZ066_RS04895 (DZ066_04895) | - | 915978..916343 (+) | 366 | WP_030126607.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DZ066_RS04900 (DZ066_04900) | - | 916340..916729 (+) | 390 | WP_011284850.1 | hypothetical protein | - |
| DZ066_RS04905 (DZ066_04905) | - | 916784..917407 (+) | 624 | WP_030126608.1 | phage major tail protein, TP901-1 family | - |
| DZ066_RS04910 (DZ066_04910) | - | 917461..917814 (+) | 354 | WP_002990023.1 | tail assembly chaperone | - |
| DZ066_RS04915 (DZ066_04915) | - | 917889..918185 (+) | 297 | WP_021340179.1 | hypothetical protein | - |
| DZ066_RS04920 (DZ066_04920) | - | 918200..921835 (+) | 3636 | WP_011284846.1 | tape measure protein | - |
| DZ066_RS04925 (DZ066_04925) | - | 921867..922646 (+) | 780 | WP_011284845.1 | distal tail protein Dit | - |
| DZ066_RS04930 (DZ066_04930) | - | 922643..924697 (+) | 2055 | WP_011284844.1 | phage tail spike protein | - |
| DZ066_RS04935 (DZ066_04935) | - | 924694..925908 (+) | 1215 | WP_011284843.1 | hypothetical protein | - |
| DZ066_RS04940 (DZ066_04940) | - | 925910..926224 (+) | 315 | WP_063812987.1 | hypothetical protein | - |
| DZ066_RS04945 (DZ066_04945) | - | 926235..928130 (+) | 1896 | WP_129820727.1 | gp58-like family protein | - |
| DZ066_RS04950 (DZ066_04950) | - | 928144..928305 (+) | 162 | WP_002988795.1 | hypothetical protein | - |
| DZ066_RS04955 (DZ066_04955) | - | 928308..928925 (+) | 618 | WP_011284840.1 | hypothetical protein | - |
| DZ066_RS04960 (DZ066_04960) | - | 928936..929232 (+) | 297 | WP_002990012.1 | hypothetical protein | - |
| DZ066_RS04965 (DZ066_04965) | - | 929229..929414 (+) | 186 | WP_011284839.1 | holin | - |
| DZ066_RS04970 (DZ066_04970) | - | 929526..930860 (+) | 1335 | WP_011284838.1 | GH25 family lysozyme | - |
| DZ066_RS04975 (DZ066_04975) | speC | 930936..931643 (-) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| DZ066_RS04980 (DZ066_04980) | mf2 | 931754..932512 (-) | 759 | WP_011184727.1 | DNase Mf2 | - |
| DZ066_RS04985 (DZ066_04985) | prx | 932752..932940 (+) | 189 | WP_002993136.1 | hypothetical protein | Regulator |
| DZ066_RS04995 (DZ066_04995) | - | 933531..934145 (+) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| DZ066_RS05000 (DZ066_05000) | - | 934272..935057 (-) | 786 | WP_002984433.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7239.28 Da Isoelectric Point: 3.9944
>NTDB_id=308105 DZ066_RS04985 WP_002993136.1 932752..932940(+) (prx) [Streptococcus pyogenes strain MGAS29284]
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=308105 DZ066_RS04985 WP_002993136.1 932752..932940(+) (prx) [Streptococcus pyogenes strain MGAS29284]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85.484 |
100 |
0.855 |
| prx | Streptococcus pyogenes MGAS8232 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
79.31 |
93.548 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
95.238 |
67.742 |
0.645 |
| prx | Streptococcus pyogenes MGAS315 |
80.488 |
66.129 |
0.532 |