Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DZ066_RS03740 | Genome accession | NZ_CP031619 |
| Coordinates | 692049..692231 (+) | Length | 60 a.a. |
| NCBI ID | WP_002986897.1 | Uniprot ID | A0A660A6E2 |
| Organism | Streptococcus pyogenes strain MGAS29284 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 649724..692231 | 692049..692231 | within | 0 |
Gene organization within MGE regions
Location: 649724..692231
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DZ066_RS03390 (DZ066_03390) | - | 649724..650821 (-) | 1098 | WP_032463383.1 | site-specific integrase | - |
| DZ066_RS03395 (DZ066_03395) | - | 650997..651518 (-) | 522 | WP_002986895.1 | hypothetical protein | - |
| DZ066_RS03400 (DZ066_03400) | - | 651529..651909 (-) | 381 | WP_076634137.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DZ066_RS03405 (DZ066_03405) | - | 651923..652282 (-) | 360 | WP_011054768.1 | helix-turn-helix transcriptional regulator | - |
| DZ066_RS03410 (DZ066_03410) | - | 652701..652796 (-) | 96 | WP_020837683.1 | type I toxin-antitoxin system Fst family toxin | - |
| DZ066_RS03415 (DZ066_03415) | - | 653431..653622 (+) | 192 | WP_002986891.1 | hypothetical protein | - |
| DZ066_RS03420 (DZ066_03420) | - | 653633..654361 (+) | 729 | WP_002986890.1 | phage antirepressor KilAC domain-containing protein | - |
| DZ066_RS10075 | - | 654394..654543 (+) | 150 | WP_002986888.1 | hypothetical protein | - |
| DZ066_RS03425 (DZ066_03425) | - | 654540..654740 (-) | 201 | WP_002986887.1 | KTSC domain-containing protein | - |
| DZ066_RS03430 (DZ066_03430) | - | 654819..655067 (+) | 249 | WP_023611035.1 | hypothetical protein | - |
| DZ066_RS03435 (DZ066_03435) | - | 655041..655256 (-) | 216 | WP_023611028.1 | hypothetical protein | - |
| DZ066_RS03440 (DZ066_03440) | - | 655362..655619 (+) | 258 | WP_032463372.1 | hypothetical protein | - |
| DZ066_RS03445 (DZ066_03445) | - | 655648..655833 (+) | 186 | WP_002986881.1 | hypothetical protein | - |
| DZ066_RS03450 (DZ066_03450) | - | 655927..656184 (+) | 258 | WP_019418742.1 | hypothetical protein | - |
| DZ066_RS03455 (DZ066_03455) | - | 656336..656746 (+) | 411 | WP_172450154.1 | DnaD domain protein | - |
| DZ066_RS03460 (DZ066_03460) | - | 656727..656939 (+) | 213 | WP_002986875.1 | hypothetical protein | - |
| DZ066_RS03470 (DZ066_03470) | - | 657094..657300 (+) | 207 | WP_002988357.1 | hypothetical protein | - |
| DZ066_RS03475 (DZ066_03475) | - | 657356..657685 (+) | 330 | WP_032463369.1 | hypothetical protein | - |
| DZ066_RS03480 (DZ066_03480) | - | 657688..658614 (+) | 927 | WP_011054700.1 | recombinase RecT | - |
| DZ066_RS03485 (DZ066_03485) | - | 658611..658811 (+) | 201 | WP_000594115.1 | hypothetical protein | - |
| DZ066_RS03490 (DZ066_03490) | - | 658804..659601 (+) | 798 | WP_129820724.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| DZ066_RS10085 | - | 659611..659778 (+) | 168 | WP_009880273.1 | hypothetical protein | - |
| DZ066_RS03495 (DZ066_03495) | - | 659955..660293 (+) | 339 | WP_002990067.1 | hypothetical protein | - |
| DZ066_RS03500 (DZ066_03500) | - | 660290..660802 (+) | 513 | WP_111695843.1 | hypothetical protein | - |
| DZ066_RS10250 (DZ066_03505) | - | 660789..660986 (+) | 198 | WP_011017567.1 | hypothetical protein | - |
| DZ066_RS03510 (DZ066_03510) | - | 660980..661264 (+) | 285 | WP_011017568.1 | DUF3310 domain-containing protein | - |
| DZ066_RS03515 (DZ066_03515) | - | 661261..661530 (+) | 270 | WP_002987593.1 | hypothetical protein | - |
| DZ066_RS03520 (DZ066_03520) | - | 661540..661953 (+) | 414 | WP_032460569.1 | YopX family protein | - |
| DZ066_RS03525 (DZ066_03525) | - | 661950..662234 (+) | 285 | WP_032460570.1 | hypothetical protein | - |
| DZ066_RS03530 (DZ066_03530) | - | 662236..662871 (+) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| DZ066_RS03535 (DZ066_03535) | - | 663138..663575 (+) | 438 | WP_032460571.1 | DUF1492 domain-containing protein | - |
| DZ066_RS03550 (DZ066_03550) | - | 664150..664407 (-) | 258 | WP_011054748.1 | hypothetical protein | - |
| DZ066_RS03555 (DZ066_03555) | - | 664488..665006 (+) | 519 | WP_002986854.1 | ParB N-terminal domain-containing protein | - |
| DZ066_RS03560 (DZ066_03560) | - | 664985..665662 (+) | 678 | WP_002986850.1 | ABC transporter ATP-binding protein | - |
| DZ066_RS10195 (DZ066_03565) | - | 665671..666054 (+) | 384 | WP_076639321.1 | GNAT family N-acetyltransferase | - |
| DZ066_RS03570 (DZ066_03570) | - | 666115..666492 (+) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| DZ066_RS03575 (DZ066_03575) | - | 666534..667016 (+) | 483 | WP_227874485.1 | hypothetical protein | - |
| DZ066_RS03580 (DZ066_03580) | - | 667099..668310 (+) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| DZ066_RS03585 (DZ066_03585) | - | 668324..669826 (+) | 1503 | WP_002986832.1 | phage portal protein | - |
| DZ066_RS03590 (DZ066_03590) | - | 669831..671309 (+) | 1479 | WP_111706023.1 | phage minor capsid protein | - |
| DZ066_RS03595 (DZ066_03595) | - | 671281..671520 (+) | 240 | WP_002986829.1 | hypothetical protein | - |
| DZ066_RS03600 (DZ066_03600) | - | 671582..671848 (+) | 267 | WP_011054745.1 | hypothetical protein | - |
| DZ066_RS03605 (DZ066_03605) | - | 671974..672588 (+) | 615 | WP_011106689.1 | hypothetical protein | - |
| DZ066_RS03610 (DZ066_03610) | - | 672592..673410 (+) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| DZ066_RS03615 (DZ066_03615) | - | 673464..673880 (+) | 417 | WP_111706022.1 | hypothetical protein | - |
| DZ066_RS03620 (DZ066_03620) | - | 673870..674202 (+) | 333 | WP_111711003.1 | minor capsid protein | - |
| DZ066_RS03625 (DZ066_03625) | - | 674202..674558 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| DZ066_RS03630 (DZ066_03630) | - | 674555..674953 (+) | 399 | WP_011888694.1 | minor capsid protein | - |
| DZ066_RS03635 (DZ066_03635) | - | 674953..675414 (+) | 462 | WP_011018120.1 | hypothetical protein | - |
| DZ066_RS03640 (DZ066_03640) | - | 675458..675892 (+) | 435 | WP_011888695.1 | hypothetical protein | - |
| DZ066_RS03645 (DZ066_03645) | - | 675896..676477 (+) | 582 | WP_111711002.1 | bacteriophage Gp15 family protein | - |
| DZ066_RS03650 (DZ066_03650) | - | 676467..679727 (+) | 3261 | WP_111711001.1 | tape measure protein | - |
| DZ066_RS03655 (DZ066_03655) | - | 679724..680440 (+) | 717 | WP_111711000.1 | distal tail protein Dit | - |
| DZ066_RS03660 (DZ066_03660) | - | 680437..682584 (+) | 2148 | WP_129820725.1 | phage tail spike protein | - |
| DZ066_RS03665 (DZ066_03665) | - | 682581..683804 (+) | 1224 | WP_030127718.1 | hypothetical protein | - |
| DZ066_RS03670 (DZ066_03670) | - | 683806..684120 (+) | 315 | WP_063812987.1 | hypothetical protein | - |
| DZ066_RS03675 (DZ066_03675) | - | 684131..686017 (+) | 1887 | WP_129820726.1 | gp58-like family protein | - |
| DZ066_RS03680 (DZ066_03680) | - | 686029..686460 (+) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| DZ066_RS03685 (DZ066_03685) | - | 686463..687080 (+) | 618 | WP_032461328.1 | DUF1366 domain-containing protein | - |
| DZ066_RS03690 (DZ066_03690) | - | 687090..687365 (+) | 276 | WP_002987582.1 | hypothetical protein | - |
| DZ066_RS03695 (DZ066_03695) | - | 687362..687589 (+) | 228 | WP_000609113.1 | phage holin | - |
| DZ066_RS03700 (DZ066_03700) | - | 687705..688907 (+) | 1203 | WP_023611747.1 | glucosaminidase domain-containing protein | - |
| DZ066_RS03705 (DZ066_03705) | - | 689094..689333 (-) | 240 | WP_003055855.1 | hypothetical protein | - |
| DZ066_RS03710 (DZ066_03710) | - | 689402..689617 (-) | 216 | WP_023611751.1 | hypothetical protein | - |
| DZ066_RS03715 (DZ066_03715) | - | 689619..690221 (-) | 603 | WP_023611748.1 | AP endonuclease | - |
| DZ066_RS03720 (DZ066_03720) | acrIIA3 | 690221..690595 (-) | 375 | WP_023611744.1 | anti-CRISPR protein AcrIIA3 | - |
| DZ066_RS03725 (DZ066_03725) | - | 690728..691084 (-) | 357 | WP_003055891.1 | hypothetical protein | - |
| DZ066_RS03730 (DZ066_03730) | - | 691086..691559 (-) | 474 | WP_076634523.1 | hypothetical protein | - |
| DZ066_RS03735 (DZ066_03735) | - | 691599..691838 (-) | 240 | WP_002986898.1 | hypothetical protein | - |
| DZ066_RS03740 (DZ066_03740) | prx | 692049..692231 (+) | 183 | WP_002986897.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6772.68 Da Isoelectric Point: 3.9286
>NTDB_id=308100 DZ066_RS03740 WP_002986897.1 692049..692231(+) (prx) [Streptococcus pyogenes strain MGAS29284]
MLTYDEFKQAIDDGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
MLTYDEFKQAIDDGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=308100 DZ066_RS03740 WP_002986897.1 692049..692231(+) (prx) [Streptococcus pyogenes strain MGAS29284]
ATGCTAACATACGACGAGTTTAAGCAAGCAATCGATGACGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAGCAAGCAATCGATGACGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS8232 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
68.333 |
0.567 |