Detailed information    

insolico Bioinformatically predicted

Overview


Name   prx   Type   Regulator
Locus tag   DZ106_RS04630 Genome accession   NZ_CP031618
Coordinates   902499..902687 (+) Length   62 a.a.
NCBI ID   WP_002993136.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain MGAS29326     
Function   Inhibit ComR activation (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 855743..904804 902499..902687 within 0


Gene organization within MGE regions


Location: 855743..904804
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DZ106_RS04285 (DZ106_04285) - 855743..856363 (-) 621 WP_002989605.1 DUF3862 domain-containing protein -
  DZ106_RS04290 (DZ106_04290) - 856726..857814 (-) 1089 WP_023079773.1 site-specific integrase -
  DZ106_RS04295 (DZ106_04295) - 858064..858873 (-) 810 WP_023079768.1 type II toxin-antitoxin system PemK/MazF family toxin -
  DZ106_RS04300 (DZ106_04300) - 858886..859629 (-) 744 WP_011284884.1 S24 family peptidase -
  DZ106_RS09900 - 859987..860136 (+) 150 WP_021340643.1 hypothetical protein -
  DZ106_RS04305 (DZ106_04305) - 860122..860337 (-) 216 WP_021341080.1 hypothetical protein -
  DZ106_RS04310 (DZ106_04310) - 860396..860554 (+) 159 WP_011284883.1 hypothetical protein -
  DZ106_RS04315 (DZ106_04315) - 860584..861183 (-) 600 WP_011284882.1 hypothetical protein -
  DZ106_RS04320 (DZ106_04320) - 861237..861446 (+) 210 WP_011284881.1 hypothetical protein -
  DZ106_RS04325 (DZ106_04325) - 861435..861821 (-) 387 WP_011054589.1 hypothetical protein -
  DZ106_RS04330 (DZ106_04330) - 861895..862122 (+) 228 WP_002984281.1 hypothetical protein -
  DZ106_RS04335 (DZ106_04335) - 862230..862739 (-) 510 WP_011017884.1 hypothetical protein -
  DZ106_RS04345 (DZ106_04345) - 862998..863207 (-) 210 WP_002984292.1 hypothetical protein -
  DZ106_RS04350 (DZ106_04350) - 863357..863596 (-) 240 WP_011284879.1 hypothetical protein -
  DZ106_RS04355 (DZ106_04355) - 863763..863948 (+) 186 WP_011054585.1 helix-turn-helix transcriptional regulator -
  DZ106_RS04360 (DZ106_04360) - 864027..864323 (+) 297 WP_011017882.1 MerR family transcriptional regulator -
  DZ106_RS04365 (DZ106_04365) - 864320..864457 (+) 138 WP_011017881.1 hypothetical protein -
  DZ106_RS04370 (DZ106_04370) - 864538..864867 (+) 330 WP_011284878.1 hypothetical protein -
  DZ106_RS04375 (DZ106_04375) - 864867..865061 (+) 195 WP_002984315.1 hypothetical protein -
  DZ106_RS04380 (DZ106_04380) - 865058..865342 (+) 285 WP_011284877.1 hypothetical protein -
  DZ106_RS04385 (DZ106_04385) - 865339..866022 (+) 684 WP_002984321.1 AAA family ATPase -
  DZ106_RS04390 (DZ106_04390) - 866028..867461 (+) 1434 Protein_789 DEAD/DEAH box helicase -
  DZ106_RS04395 (DZ106_04395) - 867466..867948 (+) 483 WP_002984328.1 DUF669 domain-containing protein -
  DZ106_RS04400 (DZ106_04400) - 867966..869519 (+) 1554 WP_011284875.1 hypothetical protein -
  DZ106_RS04405 (DZ106_04405) - 869788..870657 (+) 870 WP_014635521.1 bifunctional DNA primase/polymerase -
  DZ106_RS04410 (DZ106_04410) - 870677..870961 (+) 285 WP_011284874.1 VRR-NUC domain-containing protein -
  DZ106_RS04415 (DZ106_04415) - 870945..871301 (+) 357 WP_011284873.1 hypothetical protein -
  DZ106_RS10185 (DZ106_04420) - 871298..871543 (+) 246 WP_011284872.1 hypothetical protein -
  DZ106_RS04425 (DZ106_04425) - 871543..871779 (+) 237 WP_002995955.1 DUF3310 domain-containing protein -
  DZ106_RS09905 - 871776..871946 (+) 171 WP_002995952.1 hypothetical protein -
  DZ106_RS04430 (DZ106_04430) - 871943..872227 (+) 285 WP_011284869.1 hypothetical protein -
  DZ106_RS04435 (DZ106_04435) - 872229..872861 (+) 633 WP_011888685.1 N-6 DNA methylase -
  DZ106_RS04440 (DZ106_04440) - 872866..873345 (+) 480 WP_011888686.1 DUF1642 domain-containing protein -
  DZ106_RS09910 - 873342..873512 (+) 171 WP_002987493.1 hypothetical protein -
  DZ106_RS04445 (DZ106_04445) - 873794..874228 (+) 435 WP_011284866.1 ArpU family phage packaging/lysis transcriptional regulator -
  DZ106_RS04455 (DZ106_04455) - 874806..875720 (+) 915 WP_011284864.1 hypothetical protein -
  DZ106_RS09915 - 875810..876043 (-) 234 WP_002995461.1 hypothetical protein -
  DZ106_RS04465 (DZ106_04465) - 876338..876715 (-) 378 WP_002987543.1 type II toxin-antitoxin system HicB family antitoxin -
  DZ106_RS04470 (DZ106_04470) - 876767..876952 (-) 186 WP_001132273.1 type II toxin-antitoxin system HicA family toxin -
  DZ106_RS04475 (DZ106_04475) - 877051..877482 (+) 432 WP_023079766.1 terminase small subunit -
  DZ106_RS04480 (DZ106_04480) - 877460..878767 (+) 1308 WP_020833530.1 PBSX family phage terminase large subunit -
  DZ106_RS04485 (DZ106_04485) - 878779..880281 (+) 1503 WP_002984369.1 phage portal protein -
  DZ106_RS04490 (DZ106_04490) - 880262..881824 (+) 1563 WP_011284860.1 phage head morphogenesis protein -
  DZ106_RS04495 (DZ106_04495) - 881828..882013 (+) 186 WP_002988389.1 hypothetical protein -
  DZ106_RS04500 (DZ106_04500) - 882083..882397 (+) 315 WP_011284859.1 hypothetical protein -
  DZ106_RS04505 (DZ106_04505) - 882400..882666 (+) 267 WP_011284858.1 hypothetical protein -
  DZ106_RS04510 (DZ106_04510) - 882810..883343 (+) 534 WP_023079765.1 DUF4355 domain-containing protein -
  DZ106_RS04515 (DZ106_04515) - 883353..883733 (+) 381 WP_011284856.1 head decoration protein -
  DZ106_RS04520 (DZ106_04520) - 883736..884818 (+) 1083 WP_011284855.1 major capsid protein -
  DZ106_RS04525 (DZ106_04525) - 884828..885070 (+) 243 WP_011284854.1 HeH/LEM domain-containing protein -
  DZ106_RS04530 (DZ106_04530) - 885084..885437 (+) 354 WP_002984392.1 phage head-tail connector protein -
  DZ106_RS04535 (DZ106_04535) - 885434..885742 (+) 309 WP_011284852.1 hypothetical protein -
  DZ106_RS04540 (DZ106_04540) - 885723..886088 (+) 366 WP_030126607.1 HK97-gp10 family putative phage morphogenesis protein -
  DZ106_RS04545 (DZ106_04545) - 886085..886474 (+) 390 WP_011284850.1 hypothetical protein -
  DZ106_RS04550 (DZ106_04550) - 886529..887152 (+) 624 WP_030126608.1 phage major tail protein, TP901-1 family -
  DZ106_RS04555 (DZ106_04555) - 887206..887559 (+) 354 WP_002990023.1 tail assembly chaperone -
  DZ106_RS04560 (DZ106_04560) - 887634..887930 (+) 297 WP_021340179.1 hypothetical protein -
  DZ106_RS04565 (DZ106_04565) - 887945..891580 (+) 3636 WP_011284846.1 tape measure protein -
  DZ106_RS04570 (DZ106_04570) - 891612..892391 (+) 780 WP_011284845.1 distal tail protein Dit -
  DZ106_RS04575 (DZ106_04575) - 892388..894442 (+) 2055 WP_011284844.1 phage tail spike protein -
  DZ106_RS04580 (DZ106_04580) - 894439..895653 (+) 1215 WP_011284843.1 hypothetical protein -
  DZ106_RS04585 (DZ106_04585) - 895655..895969 (+) 315 WP_021340983.1 hypothetical protein -
  DZ106_RS04590 (DZ106_04590) - 895980..897875 (+) 1896 WP_011284841.1 gp58-like family protein -
  DZ106_RS04595 (DZ106_04595) - 897889..898050 (+) 162 WP_002988795.1 hypothetical protein -
  DZ106_RS04600 (DZ106_04600) - 898053..898670 (+) 618 WP_011284840.1 hypothetical protein -
  DZ106_RS04605 (DZ106_04605) - 898681..898977 (+) 297 WP_002990012.1 hypothetical protein -
  DZ106_RS04610 (DZ106_04610) - 898974..899159 (+) 186 WP_011284839.1 holin -
  DZ106_RS04615 (DZ106_04615) - 899271..900605 (+) 1335 WP_011284838.1 GH25 family lysozyme -
  DZ106_RS04620 (DZ106_04620) speC 900681..901388 (-) 708 WP_002985327.1 streptococcal pyrogenic exotoxin SpeC -
  DZ106_RS04625 (DZ106_04625) mf2 901499..902257 (-) 759 WP_011184727.1 DNase Mf2 -
  DZ106_RS04630 (DZ106_04630) prx 902499..902687 (+) 189 WP_002993136.1 hypothetical protein Regulator
  DZ106_RS04640 (DZ106_04640) - 903278..903892 (+) 615 WP_002989607.1 TVP38/TMEM64 family protein -
  DZ106_RS04645 (DZ106_04645) - 904019..904804 (-) 786 WP_002984433.1 hypothetical protein -

Sequence


Protein


Download         Length: 62 a.a.        Molecular weight: 7239.28 Da        Isoelectric Point: 3.9944

>NTDB_id=308050 DZ106_RS04630 WP_002993136.1 902499..902687(+) (prx) [Streptococcus pyogenes strain MGAS29326]
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK

Nucleotide


Download         Length: 189 bp        

>NTDB_id=308050 DZ106_RS04630 WP_002993136.1 902499..902687(+) (prx) [Streptococcus pyogenes strain MGAS29326]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  prx Streptococcus pyogenes MGAS315

85.484

100

0.855

  prx Streptococcus pyogenes MGAS8232

82.759

93.548

0.774

  prx Streptococcus pyogenes MGAS315

81.356

95.161

0.774

  prx Streptococcus pyogenes MGAS315

81.356

95.161

0.774

  prx Streptococcus pyogenes MGAS315

79.31

93.548

0.742

  prx Streptococcus pyogenes MGAS315

95.238

67.742

0.645

  prx Streptococcus pyogenes MGAS315

80.488

66.129

0.532


Multiple sequence alignment