Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DZ106_RS04630 | Genome accession | NZ_CP031618 |
| Coordinates | 902499..902687 (+) | Length | 62 a.a. |
| NCBI ID | WP_002993136.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS29326 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 855743..904804 | 902499..902687 | within | 0 |
Gene organization within MGE regions
Location: 855743..904804
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DZ106_RS04285 (DZ106_04285) | - | 855743..856363 (-) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
| DZ106_RS04290 (DZ106_04290) | - | 856726..857814 (-) | 1089 | WP_023079773.1 | site-specific integrase | - |
| DZ106_RS04295 (DZ106_04295) | - | 858064..858873 (-) | 810 | WP_023079768.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| DZ106_RS04300 (DZ106_04300) | - | 858886..859629 (-) | 744 | WP_011284884.1 | S24 family peptidase | - |
| DZ106_RS09900 | - | 859987..860136 (+) | 150 | WP_021340643.1 | hypothetical protein | - |
| DZ106_RS04305 (DZ106_04305) | - | 860122..860337 (-) | 216 | WP_021341080.1 | hypothetical protein | - |
| DZ106_RS04310 (DZ106_04310) | - | 860396..860554 (+) | 159 | WP_011284883.1 | hypothetical protein | - |
| DZ106_RS04315 (DZ106_04315) | - | 860584..861183 (-) | 600 | WP_011284882.1 | hypothetical protein | - |
| DZ106_RS04320 (DZ106_04320) | - | 861237..861446 (+) | 210 | WP_011284881.1 | hypothetical protein | - |
| DZ106_RS04325 (DZ106_04325) | - | 861435..861821 (-) | 387 | WP_011054589.1 | hypothetical protein | - |
| DZ106_RS04330 (DZ106_04330) | - | 861895..862122 (+) | 228 | WP_002984281.1 | hypothetical protein | - |
| DZ106_RS04335 (DZ106_04335) | - | 862230..862739 (-) | 510 | WP_011017884.1 | hypothetical protein | - |
| DZ106_RS04345 (DZ106_04345) | - | 862998..863207 (-) | 210 | WP_002984292.1 | hypothetical protein | - |
| DZ106_RS04350 (DZ106_04350) | - | 863357..863596 (-) | 240 | WP_011284879.1 | hypothetical protein | - |
| DZ106_RS04355 (DZ106_04355) | - | 863763..863948 (+) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| DZ106_RS04360 (DZ106_04360) | - | 864027..864323 (+) | 297 | WP_011017882.1 | MerR family transcriptional regulator | - |
| DZ106_RS04365 (DZ106_04365) | - | 864320..864457 (+) | 138 | WP_011017881.1 | hypothetical protein | - |
| DZ106_RS04370 (DZ106_04370) | - | 864538..864867 (+) | 330 | WP_011284878.1 | hypothetical protein | - |
| DZ106_RS04375 (DZ106_04375) | - | 864867..865061 (+) | 195 | WP_002984315.1 | hypothetical protein | - |
| DZ106_RS04380 (DZ106_04380) | - | 865058..865342 (+) | 285 | WP_011284877.1 | hypothetical protein | - |
| DZ106_RS04385 (DZ106_04385) | - | 865339..866022 (+) | 684 | WP_002984321.1 | AAA family ATPase | - |
| DZ106_RS04390 (DZ106_04390) | - | 866028..867461 (+) | 1434 | Protein_789 | DEAD/DEAH box helicase | - |
| DZ106_RS04395 (DZ106_04395) | - | 867466..867948 (+) | 483 | WP_002984328.1 | DUF669 domain-containing protein | - |
| DZ106_RS04400 (DZ106_04400) | - | 867966..869519 (+) | 1554 | WP_011284875.1 | hypothetical protein | - |
| DZ106_RS04405 (DZ106_04405) | - | 869788..870657 (+) | 870 | WP_014635521.1 | bifunctional DNA primase/polymerase | - |
| DZ106_RS04410 (DZ106_04410) | - | 870677..870961 (+) | 285 | WP_011284874.1 | VRR-NUC domain-containing protein | - |
| DZ106_RS04415 (DZ106_04415) | - | 870945..871301 (+) | 357 | WP_011284873.1 | hypothetical protein | - |
| DZ106_RS10185 (DZ106_04420) | - | 871298..871543 (+) | 246 | WP_011284872.1 | hypothetical protein | - |
| DZ106_RS04425 (DZ106_04425) | - | 871543..871779 (+) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| DZ106_RS09905 | - | 871776..871946 (+) | 171 | WP_002995952.1 | hypothetical protein | - |
| DZ106_RS04430 (DZ106_04430) | - | 871943..872227 (+) | 285 | WP_011284869.1 | hypothetical protein | - |
| DZ106_RS04435 (DZ106_04435) | - | 872229..872861 (+) | 633 | WP_011888685.1 | N-6 DNA methylase | - |
| DZ106_RS04440 (DZ106_04440) | - | 872866..873345 (+) | 480 | WP_011888686.1 | DUF1642 domain-containing protein | - |
| DZ106_RS09910 | - | 873342..873512 (+) | 171 | WP_002987493.1 | hypothetical protein | - |
| DZ106_RS04445 (DZ106_04445) | - | 873794..874228 (+) | 435 | WP_011284866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DZ106_RS04455 (DZ106_04455) | - | 874806..875720 (+) | 915 | WP_011284864.1 | hypothetical protein | - |
| DZ106_RS09915 | - | 875810..876043 (-) | 234 | WP_002995461.1 | hypothetical protein | - |
| DZ106_RS04465 (DZ106_04465) | - | 876338..876715 (-) | 378 | WP_002987543.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| DZ106_RS04470 (DZ106_04470) | - | 876767..876952 (-) | 186 | WP_001132273.1 | type II toxin-antitoxin system HicA family toxin | - |
| DZ106_RS04475 (DZ106_04475) | - | 877051..877482 (+) | 432 | WP_023079766.1 | terminase small subunit | - |
| DZ106_RS04480 (DZ106_04480) | - | 877460..878767 (+) | 1308 | WP_020833530.1 | PBSX family phage terminase large subunit | - |
| DZ106_RS04485 (DZ106_04485) | - | 878779..880281 (+) | 1503 | WP_002984369.1 | phage portal protein | - |
| DZ106_RS04490 (DZ106_04490) | - | 880262..881824 (+) | 1563 | WP_011284860.1 | phage head morphogenesis protein | - |
| DZ106_RS04495 (DZ106_04495) | - | 881828..882013 (+) | 186 | WP_002988389.1 | hypothetical protein | - |
| DZ106_RS04500 (DZ106_04500) | - | 882083..882397 (+) | 315 | WP_011284859.1 | hypothetical protein | - |
| DZ106_RS04505 (DZ106_04505) | - | 882400..882666 (+) | 267 | WP_011284858.1 | hypothetical protein | - |
| DZ106_RS04510 (DZ106_04510) | - | 882810..883343 (+) | 534 | WP_023079765.1 | DUF4355 domain-containing protein | - |
| DZ106_RS04515 (DZ106_04515) | - | 883353..883733 (+) | 381 | WP_011284856.1 | head decoration protein | - |
| DZ106_RS04520 (DZ106_04520) | - | 883736..884818 (+) | 1083 | WP_011284855.1 | major capsid protein | - |
| DZ106_RS04525 (DZ106_04525) | - | 884828..885070 (+) | 243 | WP_011284854.1 | HeH/LEM domain-containing protein | - |
| DZ106_RS04530 (DZ106_04530) | - | 885084..885437 (+) | 354 | WP_002984392.1 | phage head-tail connector protein | - |
| DZ106_RS04535 (DZ106_04535) | - | 885434..885742 (+) | 309 | WP_011284852.1 | hypothetical protein | - |
| DZ106_RS04540 (DZ106_04540) | - | 885723..886088 (+) | 366 | WP_030126607.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DZ106_RS04545 (DZ106_04545) | - | 886085..886474 (+) | 390 | WP_011284850.1 | hypothetical protein | - |
| DZ106_RS04550 (DZ106_04550) | - | 886529..887152 (+) | 624 | WP_030126608.1 | phage major tail protein, TP901-1 family | - |
| DZ106_RS04555 (DZ106_04555) | - | 887206..887559 (+) | 354 | WP_002990023.1 | tail assembly chaperone | - |
| DZ106_RS04560 (DZ106_04560) | - | 887634..887930 (+) | 297 | WP_021340179.1 | hypothetical protein | - |
| DZ106_RS04565 (DZ106_04565) | - | 887945..891580 (+) | 3636 | WP_011284846.1 | tape measure protein | - |
| DZ106_RS04570 (DZ106_04570) | - | 891612..892391 (+) | 780 | WP_011284845.1 | distal tail protein Dit | - |
| DZ106_RS04575 (DZ106_04575) | - | 892388..894442 (+) | 2055 | WP_011284844.1 | phage tail spike protein | - |
| DZ106_RS04580 (DZ106_04580) | - | 894439..895653 (+) | 1215 | WP_011284843.1 | hypothetical protein | - |
| DZ106_RS04585 (DZ106_04585) | - | 895655..895969 (+) | 315 | WP_021340983.1 | hypothetical protein | - |
| DZ106_RS04590 (DZ106_04590) | - | 895980..897875 (+) | 1896 | WP_011284841.1 | gp58-like family protein | - |
| DZ106_RS04595 (DZ106_04595) | - | 897889..898050 (+) | 162 | WP_002988795.1 | hypothetical protein | - |
| DZ106_RS04600 (DZ106_04600) | - | 898053..898670 (+) | 618 | WP_011284840.1 | hypothetical protein | - |
| DZ106_RS04605 (DZ106_04605) | - | 898681..898977 (+) | 297 | WP_002990012.1 | hypothetical protein | - |
| DZ106_RS04610 (DZ106_04610) | - | 898974..899159 (+) | 186 | WP_011284839.1 | holin | - |
| DZ106_RS04615 (DZ106_04615) | - | 899271..900605 (+) | 1335 | WP_011284838.1 | GH25 family lysozyme | - |
| DZ106_RS04620 (DZ106_04620) | speC | 900681..901388 (-) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| DZ106_RS04625 (DZ106_04625) | mf2 | 901499..902257 (-) | 759 | WP_011184727.1 | DNase Mf2 | - |
| DZ106_RS04630 (DZ106_04630) | prx | 902499..902687 (+) | 189 | WP_002993136.1 | hypothetical protein | Regulator |
| DZ106_RS04640 (DZ106_04640) | - | 903278..903892 (+) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| DZ106_RS04645 (DZ106_04645) | - | 904019..904804 (-) | 786 | WP_002984433.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7239.28 Da Isoelectric Point: 3.9944
>NTDB_id=308050 DZ106_RS04630 WP_002993136.1 902499..902687(+) (prx) [Streptococcus pyogenes strain MGAS29326]
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=308050 DZ106_RS04630 WP_002993136.1 902499..902687(+) (prx) [Streptococcus pyogenes strain MGAS29326]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85.484 |
100 |
0.855 |
| prx | Streptococcus pyogenes MGAS8232 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
79.31 |
93.548 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
95.238 |
67.742 |
0.645 |
| prx | Streptococcus pyogenes MGAS315 |
80.488 |
66.129 |
0.532 |