Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DZ187_RS04655 | Genome accession | NZ_CP031617 |
| Coordinates | 889529..889717 (+) | Length | 62 a.a. |
| NCBI ID | WP_002993136.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS29409 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 842775..891834 | 889529..889717 | within | 0 |
Gene organization within MGE regions
Location: 842775..891834
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DZ187_RS04310 (DZ187_04310) | - | 842775..843395 (-) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
| DZ187_RS04315 (DZ187_04315) | - | 843758..844846 (-) | 1089 | WP_129795413.1 | site-specific integrase | - |
| DZ187_RS04320 (DZ187_04320) | - | 845096..845905 (-) | 810 | WP_023079768.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| DZ187_RS04325 (DZ187_04325) | - | 845918..846661 (-) | 744 | WP_011284884.1 | S24 family peptidase | - |
| DZ187_RS09695 | - | 847019..847168 (+) | 150 | WP_021340643.1 | hypothetical protein | - |
| DZ187_RS04330 (DZ187_04330) | - | 847154..847369 (-) | 216 | WP_021341080.1 | hypothetical protein | - |
| DZ187_RS04335 (DZ187_04335) | - | 847428..847586 (+) | 159 | WP_011284883.1 | hypothetical protein | - |
| DZ187_RS04340 (DZ187_04340) | - | 847616..848215 (-) | 600 | WP_011284882.1 | hypothetical protein | - |
| DZ187_RS04345 (DZ187_04345) | - | 848269..848478 (+) | 210 | WP_011284881.1 | hypothetical protein | - |
| DZ187_RS04350 (DZ187_04350) | - | 848467..848853 (-) | 387 | WP_011054589.1 | hypothetical protein | - |
| DZ187_RS04355 (DZ187_04355) | - | 848927..849154 (+) | 228 | WP_002984281.1 | hypothetical protein | - |
| DZ187_RS04360 (DZ187_04360) | - | 849262..849771 (-) | 510 | WP_011017884.1 | hypothetical protein | - |
| DZ187_RS04370 (DZ187_04370) | - | 850030..850239 (-) | 210 | WP_002984292.1 | hypothetical protein | - |
| DZ187_RS04375 (DZ187_04375) | - | 850389..850628 (-) | 240 | WP_011284879.1 | hypothetical protein | - |
| DZ187_RS04380 (DZ187_04380) | - | 850795..850980 (+) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| DZ187_RS04385 (DZ187_04385) | - | 851059..851355 (+) | 297 | WP_011017882.1 | MerR family transcriptional regulator | - |
| DZ187_RS04390 (DZ187_04390) | - | 851352..851489 (+) | 138 | WP_011017881.1 | hypothetical protein | - |
| DZ187_RS04395 (DZ187_04395) | - | 851570..851899 (+) | 330 | WP_011284878.1 | hypothetical protein | - |
| DZ187_RS04400 (DZ187_04400) | - | 851899..852093 (+) | 195 | WP_002984315.1 | hypothetical protein | - |
| DZ187_RS04405 (DZ187_04405) | - | 852090..852374 (+) | 285 | WP_011284877.1 | hypothetical protein | - |
| DZ187_RS04410 (DZ187_04410) | - | 852371..853054 (+) | 684 | WP_002984321.1 | AAA family ATPase | - |
| DZ187_RS04415 (DZ187_04415) | - | 853060..854493 (+) | 1434 | Protein_796 | DEAD/DEAH box helicase | - |
| DZ187_RS04420 (DZ187_04420) | - | 854498..854980 (+) | 483 | WP_002984328.1 | DUF669 domain-containing protein | - |
| DZ187_RS04425 (DZ187_04425) | - | 854998..856551 (+) | 1554 | WP_011284875.1 | hypothetical protein | - |
| DZ187_RS04430 (DZ187_04430) | - | 856820..857689 (+) | 870 | WP_014635521.1 | bifunctional DNA primase/polymerase | - |
| DZ187_RS04435 (DZ187_04435) | - | 857709..857993 (+) | 285 | WP_011284874.1 | VRR-NUC domain-containing protein | - |
| DZ187_RS04440 (DZ187_04440) | - | 857977..858333 (+) | 357 | WP_011284873.1 | hypothetical protein | - |
| DZ187_RS09975 (DZ187_04445) | - | 858330..858575 (+) | 246 | WP_011284872.1 | hypothetical protein | - |
| DZ187_RS04450 (DZ187_04450) | - | 858575..858811 (+) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| DZ187_RS09700 | - | 858808..858978 (+) | 171 | WP_002995952.1 | hypothetical protein | - |
| DZ187_RS04455 (DZ187_04455) | - | 858975..859259 (+) | 285 | WP_011284869.1 | hypothetical protein | - |
| DZ187_RS04460 (DZ187_04460) | - | 859261..859893 (+) | 633 | WP_011888685.1 | N-6 DNA methylase | - |
| DZ187_RS04465 (DZ187_04465) | - | 859898..860377 (+) | 480 | WP_011888686.1 | DUF1642 domain-containing protein | - |
| DZ187_RS04470 (DZ187_04470) | - | 860826..861260 (+) | 435 | WP_011284866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DZ187_RS04480 (DZ187_04480) | - | 861838..862752 (+) | 915 | WP_011284864.1 | hypothetical protein | - |
| DZ187_RS09705 | - | 862842..863075 (-) | 234 | WP_002995461.1 | hypothetical protein | - |
| DZ187_RS04490 (DZ187_04490) | - | 863370..863747 (-) | 378 | WP_002987543.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| DZ187_RS04495 (DZ187_04495) | - | 863799..863984 (-) | 186 | WP_001132273.1 | type II toxin-antitoxin system HicA family toxin | - |
| DZ187_RS04500 (DZ187_04500) | - | 864083..864514 (+) | 432 | WP_023079766.1 | terminase small subunit | - |
| DZ187_RS04505 (DZ187_04505) | - | 864492..865799 (+) | 1308 | WP_020833530.1 | PBSX family phage terminase large subunit | - |
| DZ187_RS04510 (DZ187_04510) | - | 865811..867313 (+) | 1503 | WP_002984369.1 | phage portal protein | - |
| DZ187_RS04515 (DZ187_04515) | - | 867294..868856 (+) | 1563 | WP_011284860.1 | phage head morphogenesis protein | - |
| DZ187_RS04520 (DZ187_04520) | - | 868860..869045 (+) | 186 | WP_002988389.1 | hypothetical protein | - |
| DZ187_RS04525 (DZ187_04525) | - | 869115..869429 (+) | 315 | WP_011284859.1 | hypothetical protein | - |
| DZ187_RS04530 (DZ187_04530) | - | 869432..869698 (+) | 267 | WP_011284858.1 | hypothetical protein | - |
| DZ187_RS04535 (DZ187_04535) | - | 869842..870375 (+) | 534 | WP_023079765.1 | DUF4355 domain-containing protein | - |
| DZ187_RS04540 (DZ187_04540) | - | 870385..870765 (+) | 381 | WP_011284856.1 | head decoration protein | - |
| DZ187_RS04545 (DZ187_04545) | - | 870768..871850 (+) | 1083 | WP_011284855.1 | major capsid protein | - |
| DZ187_RS04550 (DZ187_04550) | - | 871860..872102 (+) | 243 | WP_011284854.1 | HeH/LEM domain-containing protein | - |
| DZ187_RS04555 (DZ187_04555) | - | 872116..872469 (+) | 354 | WP_002984392.1 | phage head-tail connector protein | - |
| DZ187_RS04560 (DZ187_04560) | - | 872466..872774 (+) | 309 | WP_011284852.1 | hypothetical protein | - |
| DZ187_RS04565 (DZ187_04565) | - | 872755..873120 (+) | 366 | WP_030126607.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DZ187_RS04570 (DZ187_04570) | - | 873117..873506 (+) | 390 | WP_011284850.1 | hypothetical protein | - |
| DZ187_RS04575 (DZ187_04575) | - | 873561..874184 (+) | 624 | WP_030126608.1 | phage major tail protein, TP901-1 family | - |
| DZ187_RS04580 (DZ187_04580) | - | 874238..874591 (+) | 354 | WP_002990023.1 | tail assembly chaperone | - |
| DZ187_RS04585 (DZ187_04585) | - | 874666..874962 (+) | 297 | WP_021340179.1 | hypothetical protein | - |
| DZ187_RS04590 (DZ187_04590) | - | 874977..878612 (+) | 3636 | WP_011284846.1 | tape measure protein | - |
| DZ187_RS04595 (DZ187_04595) | - | 878644..879423 (+) | 780 | WP_011284845.1 | distal tail protein Dit | - |
| DZ187_RS04600 (DZ187_04600) | - | 879420..881474 (+) | 2055 | WP_011284844.1 | phage tail spike protein | - |
| DZ187_RS04605 (DZ187_04605) | - | 881471..882685 (+) | 1215 | WP_011284843.1 | hypothetical protein | - |
| DZ187_RS04610 (DZ187_04610) | - | 882687..883001 (+) | 315 | WP_242493588.1 | hypothetical protein | - |
| DZ187_RS04615 (DZ187_04615) | - | 883012..884907 (+) | 1896 | WP_011284841.1 | gp58-like family protein | - |
| DZ187_RS04620 (DZ187_04620) | - | 884921..885082 (+) | 162 | WP_002988795.1 | hypothetical protein | - |
| DZ187_RS04625 (DZ187_04625) | - | 885085..885702 (+) | 618 | WP_011284840.1 | hypothetical protein | - |
| DZ187_RS04630 (DZ187_04630) | - | 885713..886009 (+) | 297 | WP_002990012.1 | hypothetical protein | - |
| DZ187_RS04635 (DZ187_04635) | - | 886006..886191 (+) | 186 | WP_011284839.1 | holin | - |
| DZ187_RS04640 (DZ187_04640) | - | 886303..887637 (+) | 1335 | WP_011284838.1 | GH25 family lysozyme | - |
| DZ187_RS04645 (DZ187_04645) | speC | 887713..888420 (-) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| DZ187_RS04650 (DZ187_04650) | mf2 | 888531..889289 (-) | 759 | WP_011184727.1 | DNase Mf2 | - |
| DZ187_RS04655 (DZ187_04655) | prx | 889529..889717 (+) | 189 | WP_002993136.1 | hypothetical protein | Regulator |
| DZ187_RS04665 (DZ187_04665) | - | 890308..890922 (+) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| DZ187_RS04670 (DZ187_04670) | - | 891049..891834 (-) | 786 | WP_002984433.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7239.28 Da Isoelectric Point: 3.9944
>NTDB_id=307998 DZ187_RS04655 WP_002993136.1 889529..889717(+) (prx) [Streptococcus pyogenes strain MGAS29409]
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
MLTYDEFKQAIDNGYITGDTVIIVRKNGQIFDYVLPGEKVRPWEVVTEEVVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=307998 DZ187_RS04655 WP_002993136.1 889529..889717(+) (prx) [Streptococcus pyogenes strain MGAS29409]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTAATAATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGTGAGAAAGTCAGACCATGGGAGGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85.484 |
100 |
0.855 |
| prx | Streptococcus pyogenes MGAS8232 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
81.356 |
95.161 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
79.31 |
93.548 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
95.238 |
67.742 |
0.645 |
| prx | Streptococcus pyogenes MGAS315 |
80.488 |
66.129 |
0.532 |