Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DZ187_RS02475 | Genome accession | NZ_CP031617 |
| Coordinates | 464145..464324 (+) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain MGAS29409 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 423705..464324 | 464145..464324 | within | 0 |
Gene organization within MGE regions
Location: 423705..464324
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DZ187_RS02225 (DZ187_02225) | - | 423705..424784 (-) | 1080 | WP_002988667.1 | tyrosine-type recombinase/integrase | - |
| DZ187_RS02230 (DZ187_02230) | - | 424901..425452 (-) | 552 | WP_002988670.1 | hypothetical protein | - |
| DZ187_RS02235 (DZ187_02235) | - | 425463..425846 (-) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DZ187_RS02240 (DZ187_02240) | - | 425860..426261 (-) | 402 | WP_011285676.1 | helix-turn-helix transcriptional regulator | - |
| DZ187_RS09655 | - | 426536..426691 (+) | 156 | WP_002988678.1 | hypothetical protein | - |
| DZ187_RS02245 (DZ187_02245) | - | 426672..427085 (-) | 414 | WP_002988681.1 | hypothetical protein | - |
| DZ187_RS02250 (DZ187_02250) | - | 427133..427348 (+) | 216 | WP_002988684.1 | hypothetical protein | - |
| DZ187_RS02255 (DZ187_02255) | - | 427410..427685 (+) | 276 | WP_002988687.1 | hypothetical protein | - |
| DZ187_RS02260 (DZ187_02260) | - | 427682..427852 (+) | 171 | WP_002988693.1 | hypothetical protein | - |
| DZ187_RS02265 (DZ187_02265) | - | 427845..428048 (+) | 204 | WP_002988697.1 | hypothetical protein | - |
| DZ187_RS02270 (DZ187_02270) | - | 428045..428431 (+) | 387 | WP_002988700.1 | hypothetical protein | - |
| DZ187_RS02275 (DZ187_02275) | - | 428578..428781 (+) | 204 | WP_002988705.1 | hypothetical protein | - |
| DZ187_RS02280 (DZ187_02280) | - | 428869..429168 (+) | 300 | WP_002988708.1 | hypothetical protein | - |
| DZ187_RS02285 (DZ187_02285) | - | 429168..430322 (+) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| DZ187_RS02290 (DZ187_02290) | - | 430326..430724 (+) | 399 | WP_002988715.1 | hypothetical protein | - |
| DZ187_RS02295 (DZ187_02295) | - | 430735..431292 (+) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| DZ187_RS02300 (DZ187_02300) | - | 431335..433257 (+) | 1923 | WP_002988723.1 | DNA polymerase | - |
| DZ187_RS02305 (DZ187_02305) | - | 433262..435646 (+) | 2385 | WP_129795404.1 | phage/plasmid primase, P4 family | - |
| DZ187_RS02310 (DZ187_02310) | - | 436035..436310 (+) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| DZ187_RS02315 (DZ187_02315) | - | 436307..437629 (+) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| DZ187_RS09660 | - | 437630..437797 (+) | 168 | WP_165354939.1 | hypothetical protein | - |
| DZ187_RS02320 (DZ187_02320) | - | 437794..438060 (+) | 267 | WP_002988738.1 | hypothetical protein | - |
| DZ187_RS02325 (DZ187_02325) | - | 438069..438920 (+) | 852 | WP_129795405.1 | site-specific DNA-methyltransferase | - |
| DZ187_RS02330 (DZ187_02330) | - | 438910..439101 (+) | 192 | WP_002988743.1 | hypothetical protein | - |
| DZ187_RS02335 (DZ187_02335) | - | 439098..439514 (+) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| DZ187_RS02340 (DZ187_02340) | - | 439604..440056 (+) | 453 | WP_011106637.1 | terminase small subunit | - |
| DZ187_RS02345 (DZ187_02345) | - | 440046..441323 (+) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| DZ187_RS02350 (DZ187_02350) | - | 441339..442871 (+) | 1533 | WP_002988758.1 | phage portal protein | - |
| DZ187_RS02355 (DZ187_02355) | - | 442831..444276 (+) | 1446 | WP_015446273.1 | minor capsid protein | - |
| DZ187_RS02360 (DZ187_02360) | - | 444307..444495 (+) | 189 | WP_002983423.1 | hypothetical protein | - |
| DZ187_RS02365 (DZ187_02365) | - | 444498..444764 (+) | 267 | WP_002988765.1 | hypothetical protein | - |
| DZ187_RS02370 (DZ187_02370) | - | 444920..445489 (+) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| DZ187_RS02375 (DZ187_02375) | - | 445502..446389 (+) | 888 | WP_002988771.1 | hypothetical protein | - |
| DZ187_RS02380 (DZ187_02380) | - | 446401..446757 (+) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| DZ187_RS02385 (DZ187_02385) | - | 446768..447046 (+) | 279 | WP_000639437.1 | hypothetical protein | - |
| DZ187_RS02390 (DZ187_02390) | - | 447043..447387 (+) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DZ187_RS02395 (DZ187_02395) | - | 447391..447750 (+) | 360 | WP_002988782.1 | hypothetical protein | - |
| DZ187_RS02400 (DZ187_02400) | - | 447762..448361 (+) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| DZ187_RS02405 (DZ187_02405) | - | 448415..448870 (+) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| DZ187_RS02410 (DZ187_02410) | - | 448945..449178 (+) | 234 | WP_002983445.1 | hypothetical protein | - |
| DZ187_RS02415 (DZ187_02415) | - | 449193..453575 (+) | 4383 | WP_002988786.1 | tape measure protein | - |
| DZ187_RS02420 (DZ187_02420) | - | 453587..454429 (+) | 843 | WP_002988788.1 | phage tail family protein | - |
| DZ187_RS02425 (DZ187_02425) | - | 454439..456421 (+) | 1983 | WP_002988790.1 | phage tail protein | - |
| DZ187_RS02430 (DZ187_02430) | - | 456418..457473 (+) | 1056 | WP_002988439.1 | hypothetical protein | - |
| DZ187_RS02435 (DZ187_02435) | - | 457473..458108 (+) | 636 | WP_021341117.1 | hypothetical protein | - |
| DZ187_RS02440 (DZ187_02440) | - | 458119..460026 (+) | 1908 | WP_021341125.1 | gp58-like family protein | - |
| DZ187_RS02445 (DZ187_02445) | - | 460035..460196 (+) | 162 | WP_002988795.1 | hypothetical protein | - |
| DZ187_RS02450 (DZ187_02450) | - | 460199..460819 (+) | 621 | WP_002988797.1 | hypothetical protein | - |
| DZ187_RS02455 (DZ187_02455) | - | 460830..461129 (+) | 300 | WP_002988799.1 | hypothetical protein | - |
| DZ187_RS02460 (DZ187_02460) | - | 461126..461311 (+) | 186 | WP_002988802.1 | holin | - |
| DZ187_RS02465 (DZ187_02465) | - | 461422..462618 (+) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| DZ187_RS02470 (DZ187_02470) | sda1 | 462734..463906 (-) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| DZ187_RS02475 (DZ187_02475) | prx | 464145..464324 (+) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=307989 DZ187_RS02475 WP_002988813.1 464145..464324(+) (prx) [Streptococcus pyogenes strain MGAS29409]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=307989 DZ187_RS02475 WP_002988813.1 464145..464324(+) (prx) [Streptococcus pyogenes strain MGAS29409]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |