Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | DWB87_RS05330 | Genome accession | NZ_CP031265 |
| Coordinates | 1066081..1066500 (+) | Length | 139 a.a. |
| NCBI ID | WP_145392944.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 13 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1058388..1103916 | 1066081..1066500 | within | 0 |
Gene organization within MGE regions
Location: 1058388..1103916
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DWB87_RS05260 (DWB87_05355) | - | 1058388..1059773 (-) | 1386 | WP_145392939.1 | recombinase family protein | - |
| DWB87_RS13955 | - | 1059827..1060204 (-) | 378 | WP_224089440.1 | hypothetical protein | - |
| DWB87_RS05270 (DWB87_05365) | - | 1060197..1060718 (-) | 522 | WP_145392940.1 | hypothetical protein | - |
| DWB87_RS05275 (DWB87_05370) | - | 1060834..1061379 (-) | 546 | WP_061735314.1 | Ltp family lipoprotein | - |
| DWB87_RS05280 (DWB87_05375) | - | 1061430..1062062 (-) | 633 | WP_061735313.1 | XRE family transcriptional regulator | - |
| DWB87_RS05285 (DWB87_05380) | - | 1062216..1062443 (+) | 228 | WP_069993619.1 | helix-turn-helix transcriptional regulator | - |
| DWB87_RS05290 (DWB87_05385) | - | 1062466..1063218 (+) | 753 | WP_001148617.1 | phage antirepressor KilAC domain-containing protein | - |
| DWB87_RS05295 (DWB87_05390) | - | 1063234..1063377 (+) | 144 | WP_070003272.1 | hypothetical protein | - |
| DWB87_RS05300 (DWB87_05395) | - | 1063387..1063989 (-) | 603 | WP_145392941.1 | hypothetical protein | - |
| DWB87_RS05305 (DWB87_05400) | - | 1064170..1064331 (+) | 162 | WP_001285954.1 | DUF1270 domain-containing protein | - |
| DWB87_RS05310 (DWB87_05405) | - | 1064467..1064727 (+) | 261 | WP_000291075.1 | DUF1108 family protein | - |
| DWB87_RS05315 (DWB87_05410) | - | 1064735..1064971 (+) | 237 | WP_000802315.1 | hypothetical protein | - |
| DWB87_RS05320 (DWB87_05415) | - | 1064964..1065443 (+) | 480 | WP_145392942.1 | siphovirus Gp157 family protein | - |
| DWB87_RS05325 (DWB87_05420) | - | 1065443..1066081 (+) | 639 | WP_145392943.1 | ERF family protein | - |
| DWB87_RS05330 (DWB87_05425) | ssbA | 1066081..1066500 (+) | 420 | WP_145392944.1 | single-stranded DNA-binding protein | Machinery gene |
| DWB87_RS05335 (DWB87_05430) | - | 1066514..1067182 (+) | 669 | WP_145392945.1 | putative HNHc nuclease | - |
| DWB87_RS05340 (DWB87_05435) | - | 1067182..1067964 (+) | 783 | WP_031913258.1 | AP2 domain-containing protein | - |
| DWB87_RS05345 (DWB87_05440) | - | 1067936..1068745 (+) | 810 | WP_145392946.1 | phage replisome organizer N-terminal domain-containing protein | - |
| DWB87_RS05350 (DWB87_05445) | - | 1068745..1069101 (+) | 357 | WP_001132243.1 | hypothetical protein | - |
| DWB87_RS05355 (DWB87_05450) | - | 1069098..1070339 (+) | 1242 | WP_031911826.1 | DnaB helicase C-terminal domain-containing protein | - |
| DWB87_RS05360 (DWB87_05455) | - | 1070336..1070551 (+) | 216 | WP_070021241.1 | hypothetical protein | - |
| DWB87_RS05365 (DWB87_05460) | - | 1070554..1070775 (+) | 222 | WP_001123688.1 | DUF3269 family protein | - |
| DWB87_RS05370 (DWB87_05465) | - | 1070786..1071190 (+) | 405 | WP_000049784.1 | DUF1064 domain-containing protein | - |
| DWB87_RS05375 (DWB87_05470) | - | 1071195..1071380 (+) | 186 | WP_145392948.1 | DUF3113 family protein | - |
| DWB87_RS05380 (DWB87_05475) | - | 1071381..1071649 (+) | 269 | Protein_1023 | helix-turn-helix domain-containing protein | - |
| DWB87_RS05385 (DWB87_05480) | - | 1071650..1072006 (+) | 357 | WP_145392950.1 | SA1788 family PVL leukocidin-associated protein | - |
| DWB87_RS05390 (DWB87_05485) | - | 1072010..1072252 (+) | 243 | WP_145392951.1 | SAV1978 family virulence-associated passenger protein | - |
| DWB87_RS05395 (DWB87_05490) | - | 1072324..1072551 (+) | 228 | Protein_1026 | hypothetical protein | - |
| DWB87_RS05400 (DWB87_05495) | - | 1072544..1072792 (+) | 249 | WP_145392955.1 | DUF1024 family protein | - |
| DWB87_RS05405 (DWB87_05500) | - | 1072785..1073318 (+) | 534 | WP_145392957.1 | dUTP diphosphatase | - |
| DWB87_RS05410 (DWB87_05505) | - | 1073355..1073561 (+) | 207 | WP_145392959.1 | DUF1381 domain-containing protein | - |
| DWB87_RS05415 (DWB87_05510) | rinB | 1073558..1073731 (+) | 174 | WP_063815502.1 | transcriptional activator RinB | - |
| DWB87_RS05420 (DWB87_05515) | - | 1073731..1073931 (+) | 201 | WP_046594621.1 | DUF1514 family protein | - |
| DWB87_RS05425 (DWB87_05520) | - | 1073954..1074415 (+) | 462 | WP_145392961.1 | hypothetical protein | - |
| DWB87_RS05430 (DWB87_05525) | - | 1074530..1074982 (+) | 453 | WP_046594624.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| DWB87_RS05435 (DWB87_05530) | - | 1074998..1075342 (+) | 345 | WP_078103664.1 | HNH endonuclease | - |
| DWB87_RS05440 (DWB87_05535) | - | 1075471..1075941 (+) | 471 | WP_000919030.1 | phage terminase small subunit P27 family | - |
| DWB87_RS05445 (DWB87_05540) | - | 1075941..1077635 (+) | 1695 | WP_145392963.1 | terminase large subunit | - |
| DWB87_RS05455 (DWB87_05550) | - | 1077855..1079129 (+) | 1275 | WP_044132404.1 | phage portal protein | - |
| DWB87_RS05460 (DWB87_05555) | - | 1079104..1079688 (+) | 585 | WP_044132398.1 | HK97 family phage prohead protease | - |
| DWB87_RS05465 (DWB87_05560) | - | 1079776..1081011 (+) | 1236 | WP_044132392.1 | phage major capsid protein | - |
| DWB87_RS05470 (DWB87_05565) | - | 1081048..1081206 (+) | 159 | WP_001252099.1 | hypothetical protein | - |
| DWB87_RS05475 (DWB87_05570) | - | 1081215..1081547 (+) | 333 | WP_001177485.1 | head-tail connector protein | - |
| DWB87_RS05480 (DWB87_05575) | - | 1081534..1081869 (+) | 336 | WP_025174659.1 | head-tail adaptor protein | - |
| DWB87_RS05485 (DWB87_05580) | - | 1081869..1082246 (+) | 378 | WP_000501244.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DWB87_RS05490 (DWB87_05585) | - | 1082243..1082623 (+) | 381 | WP_000611451.1 | hypothetical protein | - |
| DWB87_RS05495 (DWB87_05590) | - | 1082624..1083577 (+) | 954 | WP_000570651.1 | major tail protein | - |
| DWB87_RS05500 (DWB87_05595) | gpG | 1083642..1084088 (+) | 447 | WP_000442601.1 | phage tail assembly chaperone G | - |
| DWB87_RS05505 (DWB87_05600) | gpGT | 1084148..1084270 (+) | 123 | WP_000571956.1 | phage tail assembly chaperone GT | - |
| DWB87_RS05510 (DWB87_05605) | - | 1084327..1088976 (+) | 4650 | WP_109183285.1 | phage tail tape measure protein | - |
| DWB87_RS05515 (DWB87_05610) | - | 1088976..1090466 (+) | 1491 | WP_145392967.1 | phage distal tail protein | - |
| DWB87_RS05520 (DWB87_05615) | - | 1090482..1094051 (+) | 3570 | WP_145392969.1 | phage tail spike protein | - |
| DWB87_RS05525 (DWB87_05620) | - | 1094038..1094190 (+) | 153 | WP_060552605.1 | hypothetical protein | - |
| DWB87_RS05530 (DWB87_05625) | - | 1094242..1094529 (+) | 288 | WP_060552604.1 | hypothetical protein | - |
| DWB87_RS05535 (DWB87_05630) | - | 1094586..1094882 (+) | 297 | WP_060552603.1 | DUF2951 domain-containing protein | - |
| DWB87_RS05540 (DWB87_05635) | - | 1095116..1095223 (+) | 108 | WP_000253687.1 | putative holin-like toxin | - |
| DWB87_RS05545 (DWB87_05640) | - | 1095277..1095363 (-) | 87 | Protein_1055 | hypothetical protein | - |
| DWB87_RS05550 (DWB87_05645) | - | 1095432..1095734 (+) | 303 | WP_060552602.1 | phage holin | - |
| DWB87_RS05555 (DWB87_05650) | - | 1095745..1097199 (+) | 1455 | WP_060552601.1 | N-acetylmuramoyl-L-alanine amidase | - |
| DWB87_RS05570 (DWB87_05665) | isdB | 1098756..1100693 (-) | 1938 | WP_001041586.1 | heme uptake protein IsdB | - |
| DWB87_RS05575 (DWB87_05670) | isdA | 1100896..1101948 (-) | 1053 | WP_000160859.1 | LPXTG-anchored heme-scavenging protein IsdA | - |
| DWB87_RS05580 (DWB87_05675) | isdC | 1102157..1102840 (+) | 684 | WP_000789821.1 | heme uptake protein IsdC | - |
| DWB87_RS05585 (DWB87_05680) | isdD | 1102840..1103916 (+) | 1077 | WP_001246701.1 | iron-regulated surface determinant protein IsdD | - |
Sequence
Protein
Download Length: 139 a.a. Molecular weight: 15495.05 Da Isoelectric Point: 4.9008
>NTDB_id=305218 DWB87_RS05330 WP_145392944.1 1066081..1066500(+) (ssbA) [Staphylococcus aureus strain 13]
MLNRVVLAGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVEKYLSKGSLAGVDGRLQTR
NYENKDGQRVFVTEVVADSVQFLEPKNNNQQNNQQQNGQTQTGNNPFDNTEADFSDLPF
MLNRVVLAGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVEKYLSKGSLAGVDGRLQTR
NYENKDGQRVFVTEVVADSVQFLEPKNNNQQNNQQQNGQTQTGNNPFDNTEADFSDLPF
Nucleotide
Download Length: 420 bp
>NTDB_id=305218 DWB87_RS05330 WP_145392944.1 1066081..1066500(+) (ssbA) [Staphylococcus aureus strain 13]
ATGTTAAACAGAGTAGTTTTAGCAGGACGATTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
GACATTCACATTAGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGACTTTATAAACGTAGTAGTGT
TCAAAAAACAAGCTGAAAATGTTGAAAAATACCTTTCTAAAGGATCGCTGGCAGGTGTAGACGGACGACTACAAACACGT
AACTACGAAAACAAAGACGGGCAACGTGTATTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAGAACAACCAACAACAAAACGGACAAACTCAAACTGGTAATAATCCGTTCGACAATACCGAAGCAGACT
TTTCTGACTTACCGTTCTGA
ATGTTAAACAGAGTAGTTTTAGCAGGACGATTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
GACATTCACATTAGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGACTTTATAAACGTAGTAGTGT
TCAAAAAACAAGCTGAAAATGTTGAAAAATACCTTTCTAAAGGATCGCTGGCAGGTGTAGACGGACGACTACAAACACGT
AACTACGAAAACAAAGACGGGCAACGTGTATTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAGAACAACCAACAACAAAACGGACAAACTCAAACTGGTAATAATCCGTTCGACAATACCGAAGCAGACT
TTTCTGACTTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
80.374 |
76.978 |
0.619 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.921 |
100 |
0.612 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.547 |
76.259 |
0.439 |
| ssbA | Streptococcus mutans UA159 |
43.796 |
98.561 |
0.432 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
44.03 |
96.403 |
0.424 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
48.113 |
76.259 |
0.367 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
48.113 |
76.259 |
0.367 |