Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DTA40_RS03940 | Genome accession | NZ_CP030928 |
| Coordinates | 744904..745065 (-) | Length | 53 a.a. |
| NCBI ID | WP_014727422.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain CS18 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 727366..752761 | 744904..745065 | within | 0 |
Gene organization within MGE regions
Location: 727366..752761
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DTA40_RS03875 (DTA40_03950) | glyA | 727366..728616 (+) | 1251 | WP_011227085.1 | serine hydroxymethyltransferase | - |
| DTA40_RS03880 (DTA40_03955) | - | 728623..729600 (+) | 978 | WP_014608183.1 | nucleoid-associated protein | - |
| DTA40_RS03885 (DTA40_03960) | - | 729602..730213 (+) | 612 | WP_014621429.1 | lysozyme family protein | - |
| DTA40_RS03890 (DTA40_03965) | - | 730246..731985 (+) | 1740 | WP_011681019.1 | ABC transporter ATP-binding protein | - |
| DTA40_RS03895 (DTA40_03970) | - | 731975..733723 (+) | 1749 | WP_011681020.1 | ABC transporter ATP-binding protein | - |
| DTA40_RS03900 (DTA40_03975) | - | 733900..734031 (+) | 132 | WP_002885174.1 | teichoic acid D-Ala incorporation-associated protein DltX | - |
| DTA40_RS03905 (DTA40_03980) | dltA | 734040..735590 (+) | 1551 | WP_011681022.1 | D-alanine--poly(phosphoribitol) ligase subunit DltA | - |
| DTA40_RS03910 (DTA40_03985) | dltB | 735587..736834 (+) | 1248 | WP_014608186.1 | D-alanyl-lipoteichoic acid biosynthesis protein DltB | - |
| DTA40_RS03915 (DTA40_03990) | dltC | 736852..737091 (+) | 240 | WP_002950439.1 | D-alanine--poly(phosphoribitol) ligase subunit DltC | - |
| DTA40_RS03920 (DTA40_03995) | dltD | 737084..738352 (+) | 1269 | WP_011681024.1 | D-alanyl-lipoteichoic acid biosynthesis protein DltD | - |
| DTA40_RS03925 (DTA40_04000) | - | 738405..739754 (-) | 1350 | Protein_724 | IS3 family transposase | - |
| DTA40_RS03930 (DTA40_04005) | - | 739953..742589 (-) | 2637 | WP_014621434.1 | calcium-translocating P-type ATPase, PMCA-type | - |
| DTA40_RS03935 (DTA40_04010) | pabB | 742766..744484 (-) | 1719 | WP_014608193.1 | aminodeoxychorismate synthase component I | - |
| DTA40_RS03940 | prx | 744904..745065 (-) | 162 | WP_014727422.1 | hypothetical protein | Regulator |
| DTA40_RS03945 (DTA40_04020) | - | 745549..745824 (-) | 276 | WP_014727423.1 | hypothetical protein | - |
| DTA40_RS03950 (DTA40_04025) | - | 745841..746026 (-) | 186 | WP_024704073.1 | hypothetical protein | - |
| DTA40_RS03955 (DTA40_04030) | - | 746324..747829 (-) | 1506 | WP_024704074.1 | phage/plasmid primase, P4 family | - |
| DTA40_RS03960 (DTA40_04035) | - | 747819..748679 (-) | 861 | WP_024704075.1 | primase alpha helix C-terminal domain-containing protein | - |
| DTA40_RS03965 (DTA40_04040) | - | 748694..748966 (-) | 273 | WP_011227098.1 | MerR family transcriptional regulator | - |
| DTA40_RS03970 (DTA40_04050) | - | 749209..749445 (-) | 237 | WP_024704076.1 | hypothetical protein | - |
| DTA40_RS03975 (DTA40_04055) | - | 749459..749653 (-) | 195 | WP_024704077.1 | hypothetical protein | - |
| DTA40_RS03980 (DTA40_04060) | - | 749657..749950 (-) | 294 | WP_024704078.1 | hypothetical protein | - |
| DTA40_RS03985 (DTA40_04065) | - | 750189..750386 (-) | 198 | WP_014608200.1 | helix-turn-helix transcriptional regulator | - |
| DTA40_RS03990 (DTA40_04070) | - | 750549..751061 (+) | 513 | WP_014608201.1 | helix-turn-helix transcriptional regulator | - |
| DTA40_RS03995 (DTA40_04075) | - | 751144..752310 (+) | 1167 | WP_011227104.1 | site-specific integrase | - |
| DTA40_RS04000 (DTA40_04080) | - | 752426..752761 (+) | 336 | WP_002948199.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 53 a.a. Molecular weight: 6084.95 Da Isoelectric Point: 4.2412
>NTDB_id=302422 DTA40_RS03940 WP_014727422.1 744904..745065(-) (prx) [Streptococcus thermophilus strain CS18]
MLTYDEFKEAMDKGFIKGDTVQIVRLDGEQVEPREILSLEKVSDIIKELGKDN
MLTYDEFKEAMDKGFIKGDTVQIVRLDGEQVEPREILSLEKVSDIIKELGKDN
Nucleotide
Download Length: 162 bp
>NTDB_id=302422 DTA40_RS03940 WP_014727422.1 744904..745065(-) (prx) [Streptococcus thermophilus strain CS18]
ATGCTGACTTATGATGAATTTAAAGAGGCAATGGACAAGGGTTTTATTAAAGGTGATACTGTCCAGATTGTCCGATTAGA
CGGTGAACAAGTTGAGCCACGCGAAATATTGAGCTTAGAAAAGGTATCGGATATAATAAAGGAACTAGGCAAGGACAACT
AA
ATGCTGACTTATGATGAATTTAAAGAGGCAATGGACAAGGGTTTTATTAAAGGTGATACTGTCCAGATTGTCCGATTAGA
CGGTGAACAAGTTGAGCCACGCGAAATATTGAGCTTAGAAAAGGTATCGGATATAATAAAGGAACTAGGCAAGGACAACT
AA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
48.333 |
100 |
0.547 |
| prx | Streptococcus pyogenes MGAS315 |
46.667 |
100 |
0.528 |
| prx | Streptococcus pyogenes MGAS315 |
46.667 |
100 |
0.528 |
| prx | Streptococcus pyogenes MGAS315 |
45 |
100 |
0.509 |
| prx | Streptococcus pyogenes MGAS315 |
56.818 |
83.019 |
0.472 |
| prx | Streptococcus pyogenes MGAS315 |
57.143 |
79.245 |
0.453 |
| prx | Streptococcus pyogenes MGAS315 |
60.526 |
71.698 |
0.434 |