Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DSN71_RS03540 | Genome accession | NZ_CP030845 |
| Coordinates | 615231..615419 (+) | Length | 62 a.a. |
| NCBI ID | WP_000027835.1 | Uniprot ID | A0AAV3JNT7 |
| Organism | Streptococcus agalactiae strain S73 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 606445..615189 | 615231..615419 | flank | 42 |
| IScluster/Tn | 614164..614775 | 615231..615419 | flank | 456 |
Gene organization within MGE regions
Location: 606445..615419
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DSN71_RS03500 (DSN71_03495) | - | 607824..607985 (-) | 162 | WP_000508795.1 | NINE protein | - |
| DSN71_RS03505 (DSN71_03500) | - | 608727..610004 (+) | 1278 | WP_000594360.1 | ABC transporter permease | - |
| DSN71_RS03510 (DSN71_03505) | - | 610014..610670 (+) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| DSN71_RS03515 (DSN71_03510) | - | 610670..612046 (+) | 1377 | WP_017647836.1 | FtsX-like permease family protein | - |
| DSN71_RS03520 (DSN71_03515) | - | 612143..612796 (+) | 654 | WP_000699093.1 | response regulator transcription factor | - |
| DSN71_RS03525 (DSN71_03520) | - | 612793..614112 (+) | 1320 | WP_113792444.1 | HAMP domain-containing sensor histidine kinase | - |
| DSN71_RS03530 (DSN71_03525) | - | 614164..614811 (-) | 648 | Protein_608 | IS3 family transposase | - |
| DSN71_RS03535 (DSN71_03530) | - | 614989..615189 (+) | 201 | WP_000076708.1 | CsbD family protein | - |
| DSN71_RS03540 (DSN71_03535) | prx | 615231..615419 (+) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7180.25 Da Isoelectric Point: 4.7815
>NTDB_id=301834 DSN71_RS03540 WP_000027835.1 615231..615419(+) (prx) [Streptococcus agalactiae strain S73]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
Nucleotide
Download Length: 189 bp
>NTDB_id=301834 DSN71_RS03540 WP_000027835.1 615231..615419(+) (prx) [Streptococcus agalactiae strain S73]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.222 |
87.097 |
0.629 |
| prx | Streptococcus pyogenes MGAS8232 |
69.091 |
88.71 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
87.097 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
64.516 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
61.818 |
88.71 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
74.359 |
62.903 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
78.378 |
59.677 |
0.468 |