Detailed information
Bioinformatically predicted
Overview
| Name | clpP | Type | Regulator |
| Locus tag | DP112_RS07260 | Genome accession | NZ_CP030125 |
| Coordinates | 1443780..1444391 (-) | Length | 203 a.a. |
| NCBI ID | WP_223375679.1 | Uniprot ID | - |
| Organism | Streptococcus suis strain HA1003 | ||
| Function | degradation of ComX (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1406760..1463244 | 1443780..1444391 | within | 0 |
Gene organization within MGE regions
Location: 1406760..1463244
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DP112_RS07035 (DP112_07035) | - | 1407134..1408033 (+) | 900 | WP_114866662.1 | cation transporter | - |
| DP112_RS07040 (DP112_07040) | - | 1408050..1408403 (-) | 354 | WP_002935368.1 | arsenate reductase family protein | - |
| DP112_RS07045 (DP112_07045) | - | 1408387..1408893 (-) | 507 | WP_114866663.1 | methylated-DNA--[protein]-cysteine S-methyltransferase | - |
| DP112_RS07050 (DP112_07050) | - | 1408896..1410077 (-) | 1182 | WP_014638089.1 | phosphoglycerate dehydrogenase | - |
| DP112_RS07055 (DP112_07055) | - | 1410131..1410688 (-) | 558 | WP_105095471.1 | GNAT family N-acetyltransferase | - |
| DP112_RS07060 (DP112_07060) | serC | 1410688..1411779 (-) | 1092 | WP_015646952.1 | 3-phosphoserine/phosphohydroxythreonine transaminase | - |
| DP112_RS07065 (DP112_07065) | rsmI | 1412248..1413111 (-) | 864 | WP_114866664.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
| DP112_RS07070 (DP112_07070) | yabA | 1413113..1413430 (-) | 318 | WP_002935361.1 | DNA replication initiation control protein YabA | - |
| DP112_RS07075 (DP112_07075) | - | 1413450..1414334 (-) | 885 | WP_114866665.1 | DNA polymerase III subunit delta' | - |
| DP112_RS07080 (DP112_07080) | tmk | 1414331..1414969 (-) | 639 | WP_114866666.1 | dTMP kinase | - |
| DP112_RS07085 (DP112_07085) | - | 1415410..1416276 (+) | 867 | WP_002935357.1 | YitT family protein | - |
| DP112_RS07090 (DP112_07090) | - | 1416313..1417584 (-) | 1272 | WP_105119667.1 | toxic anion resistance protein | - |
| DP112_RS07095 (DP112_07095) | - | 1417590..1418417 (-) | 828 | WP_044671605.1 | hypothetical protein | - |
| DP112_RS07100 (DP112_07100) | - | 1418511..1419167 (-) | 657 | WP_002935353.1 | CBS domain-containing protein | - |
| DP112_RS07105 (DP112_07105) | - | 1419251..1420006 (-) | 756 | WP_114866667.1 | epoxyqueuosine reductase QueH | - |
| DP112_RS07115 (DP112_07115) | - | 1420526..1421236 (-) | 711 | WP_002937288.1 | ABC transporter ATP-binding protein | - |
| DP112_RS07120 (DP112_07120) | - | 1421236..1422000 (-) | 765 | WP_002937291.1 | ABC transporter ATP-binding protein | - |
| DP112_RS07125 (DP112_07125) | - | 1422000..1422947 (-) | 948 | WP_002937293.1 | branched-chain amino acid ABC transporter permease | - |
| DP112_RS07130 (DP112_07130) | - | 1422950..1423837 (-) | 888 | WP_012027482.1 | branched-chain amino acid ABC transporter permease | - |
| DP112_RS07135 (DP112_07135) | - | 1424038..1425207 (-) | 1170 | WP_105134813.1 | ABC transporter substrate-binding protein | - |
| DP112_RS07145 (DP112_07145) | - | 1425639..1425953 (+) | 315 | WP_000420682.1 | YdcP family protein | - |
| DP112_RS07150 (DP112_07150) | - | 1425969..1426355 (+) | 387 | WP_000985015.1 | YdcP family protein | - |
| DP112_RS07155 (DP112_07155) | - | 1426384..1427769 (+) | 1386 | WP_114866669.1 | FtsK/SpoIIIE domain-containing protein | - |
| DP112_RS07160 (DP112_07160) | - | 1427772..1427924 (+) | 153 | WP_000879507.1 | hypothetical protein | - |
| DP112_RS07165 (DP112_07165) | mobT | 1427947..1429152 (+) | 1206 | WP_114866670.1 | MobT family relaxase | - |
| DP112_RS07170 (DP112_07170) | - | 1429195..1429416 (+) | 222 | WP_001009056.1 | hypothetical protein | - |
| DP112_RS07175 (DP112_07175) | - | 1429533..1430030 (+) | 498 | WP_000342539.1 | antirestriction protein ArdA | - |
| DP112_RS07180 (DP112_07180) | - | 1430119..1430511 (+) | 393 | WP_000723888.1 | conjugal transfer protein | - |
| DP112_RS07185 (DP112_07185) | - | 1430495..1432942 (+) | 2448 | WP_000331160.1 | ATP-binding protein | - |
| DP112_RS07190 (DP112_07190) | - | 1432945..1435122 (+) | 2178 | WP_000804748.1 | membrane protein | - |
| DP112_RS07195 (DP112_07195) | - | 1435119..1436120 (+) | 1002 | WP_000769868.1 | bifunctional lysozyme/C40 family peptidase | - |
| DP112_RS07200 (DP112_07200) | - | 1436117..1437052 (+) | 936 | WP_001224320.1 | conjugal transfer protein | - |
| DP112_RS07205 (DP112_07205) | - | 1437297..1437413 (+) | 117 | WP_001814923.1 | tetracycline resistance determinant leader peptide | - |
| DP112_RS07210 (DP112_07210) | tet(M) | 1437429..1439348 (+) | 1920 | WP_043029018.1 | tetracycline resistance ribosomal protection protein Tet(M) | - |
| DP112_RS07215 (DP112_07215) | - | 1439467..1439634 (+) | 168 | WP_000336323.1 | cysteine-rich KTR domain-containing protein | - |
| DP112_RS07220 (DP112_07220) | - | 1439694..1440047 (-) | 354 | WP_001227347.1 | helix-turn-helix transcriptional regulator | - |
| DP112_RS07230 (DP112_07230) | - | 1440552..1440974 (+) | 423 | WP_000804885.1 | sigma-70 family RNA polymerase sigma factor | - |
| DP112_RS07235 (DP112_07235) | - | 1440971..1441201 (+) | 231 | WP_000857133.1 | helix-turn-helix domain-containing protein | - |
| DP112_RS11280 (DP112_07240) | - | 1441427..1441678 (-) | 252 | WP_001845478.1 | hypothetical protein | - |
| DP112_RS07245 (DP112_07245) | - | 1441662..1441865 (+) | 204 | WP_000814511.1 | excisionase | - |
| DP112_RS07250 (DP112_07250) | - | 1441947..1443164 (+) | 1218 | WP_001291561.1 | tyrosine-type recombinase/integrase | - |
| DP112_RS07255 (DP112_07255) | - | 1443381..1443653 (-) | 273 | WP_024414725.1 | YlbG family protein | - |
| DP112_RS07260 (DP112_07260) | clpP | 1443780..1444391 (-) | 612 | WP_223375679.1 | ATP-dependent Clp protease proteolytic subunit | Regulator |
| DP112_RS07265 (DP112_07265) | upp | 1444493..1445122 (-) | 630 | WP_012027487.1 | uracil phosphoribosyltransferase | - |
| DP112_RS07270 (DP112_07270) | - | 1445202..1446818 (-) | 1617 | WP_114866671.1 | alpha-glucosidase | - |
| DP112_RS07275 (DP112_07275) | gtfA | 1446890..1448338 (-) | 1449 | WP_114866672.1 | sucrose phosphorylase | - |
| DP112_RS07280 (DP112_07280) | - | 1448408..1449238 (-) | 831 | WP_009910491.1 | carbohydrate ABC transporter permease | - |
| DP112_RS07285 (DP112_07285) | - | 1449249..1450121 (-) | 873 | WP_013730463.1 | sugar ABC transporter permease | - |
| DP112_RS07290 (DP112_07290) | - | 1450256..1451491 (-) | 1236 | WP_105134173.1 | extracellular solute-binding protein | - |
| DP112_RS07295 (DP112_07295) | - | 1451504..1453678 (-) | 2175 | WP_114866673.1 | alpha-galactosidase | - |
| DP112_RS07300 (DP112_07300) | - | 1453784..1454623 (+) | 840 | WP_002937318.1 | AraC family transcriptional regulator | - |
| DP112_RS07305 (DP112_07305) | - | 1454655..1455815 (-) | 1161 | WP_114866674.1 | MalY/PatB family protein | - |
| DP112_RS07310 (DP112_07310) | - | 1455819..1456910 (-) | 1092 | WP_114866675.1 | cystathionine gamma-synthase | - |
| DP112_RS07320 (DP112_07320) | - | 1457387..1457641 (+) | 255 | WP_114866677.1 | hypothetical protein | - |
| DP112_RS07325 (DP112_07325) | - | 1457651..1457902 (+) | 252 | WP_024384888.1 | hypothetical protein | - |
| DP112_RS07330 (DP112_07330) | - | 1457983..1458732 (+) | 750 | WP_105148135.1 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | - |
| DP112_RS07335 (DP112_07335) | - | 1458722..1458994 (+) | 273 | WP_105134166.1 | GIY-YIG nuclease family protein | - |
| DP112_RS07340 (DP112_07340) | - | 1459010..1459621 (-) | 612 | WP_114866678.1 | NAD(P)H-dependent oxidoreductase | - |
| DP112_RS07345 (DP112_07345) | - | 1459741..1460151 (-) | 411 | WP_114866679.1 | GNAT family N-acetyltransferase | - |
| DP112_RS07350 (DP112_07350) | - | 1460367..1460966 (-) | 600 | WP_114866680.1 | DUF1648 domain-containing protein | - |
| DP112_RS07355 (DP112_07355) | - | 1460953..1461231 (-) | 279 | WP_105112794.1 | autorepressor SdpR family transcription factor | - |
| DP112_RS07360 (DP112_07360) | - | 1461375..1462955 (-) | 1581 | WP_105121638.1 | DEAD/DEAH box helicase | - |
Sequence
Protein
Download Length: 203 a.a. Molecular weight: 22345.73 Da Isoelectric Point: 6.7324
>NTDB_id=299488 DP112_RS07260 WP_223375679.1 1443780..1444391(-) (clpP) [Streptococcus suis strain HA1003]
MSKRSNFMIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSIIAQLLFLDAQDPTKDIYLYVNTPGGSVSAGL
AIVDTMNFIKADVQTIVMGTAASMGTIIASSGAKGKRFMLPNAEYMIHQPMGGTGGGTQQTDMAIAAEHLLKTRNKLEKI
LADNSGKTVKQIHKDAERDYWMSAEETLAYGFIDQIMDNTKVK
MSKRSNFMIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSIIAQLLFLDAQDPTKDIYLYVNTPGGSVSAGL
AIVDTMNFIKADVQTIVMGTAASMGTIIASSGAKGKRFMLPNAEYMIHQPMGGTGGGTQQTDMAIAAEHLLKTRNKLEKI
LADNSGKTVKQIHKDAERDYWMSAEETLAYGFIDQIMDNTKVK
Nucleotide
Download Length: 612 bp
>NTDB_id=299488 DP112_RS07260 WP_223375679.1 1443780..1444391(-) (clpP) [Streptococcus suis strain HA1003]
ATCTCGAAAAGGAGTAATTTTATGATTCCAGTAGTTATTGAACAAACTAGCCGTGGTGAGCGCTCGTATGATATTTATTC
CCGTTTGCTCAAGGATCGCATTATCATGTTGACAGGACCAGTTGAGGACAACATGGCAAACTCTATCATTGCACAATTGC
TTTTCCTTGATGCCCAAGATCCTACAAAGGATATTTACCTCTATGTTAATACGCCAGGAGGATCGGTGTCAGCAGGTCTA
GCCATTGTAGACACGATGAATTTCATTAAAGCTGATGTTCAAACCATCGTTATGGGAACAGCTGCGAGCATGGGAACCAT
CATTGCATCAAGCGGTGCCAAGGGCAAACGTTTCATGTTGCCAAATGCAGAGTACATGATTCACCAACCGATGGGTGGAA
CAGGTGGTGGCACTCAGCAAACAGACATGGCTATTGCAGCAGAACATCTATTAAAAACACGTAATAAGCTAGAAAAAATA
TTGGCAGATAATTCAGGTAAGACAGTCAAGCAAATCCATAAGGATGCAGAACGTGATTACTGGATGTCAGCAGAAGAAAC
CTTGGCTTACGGATTTATTGACCAGATTATGGACAATACAAAAGTCAAATAA
ATCTCGAAAAGGAGTAATTTTATGATTCCAGTAGTTATTGAACAAACTAGCCGTGGTGAGCGCTCGTATGATATTTATTC
CCGTTTGCTCAAGGATCGCATTATCATGTTGACAGGACCAGTTGAGGACAACATGGCAAACTCTATCATTGCACAATTGC
TTTTCCTTGATGCCCAAGATCCTACAAAGGATATTTACCTCTATGTTAATACGCCAGGAGGATCGGTGTCAGCAGGTCTA
GCCATTGTAGACACGATGAATTTCATTAAAGCTGATGTTCAAACCATCGTTATGGGAACAGCTGCGAGCATGGGAACCAT
CATTGCATCAAGCGGTGCCAAGGGCAAACGTTTCATGTTGCCAAATGCAGAGTACATGATTCACCAACCGATGGGTGGAA
CAGGTGGTGGCACTCAGCAAACAGACATGGCTATTGCAGCAGAACATCTATTAAAAACACGTAATAAGCTAGAAAAAATA
TTGGCAGATAATTCAGGTAAGACAGTCAAGCAAATCCATAAGGATGCAGAACGTGATTACTGGATGTCAGCAGAAGAAAC
CTTGGCTTACGGATTTATTGACCAGATTATGGACAATACAAAAGTCAAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| clpP | Streptococcus pyogenes JRS4 |
92.347 |
96.552 |
0.892 |
| clpP | Streptococcus pyogenes MGAS315 |
92.347 |
96.552 |
0.892 |
| clpP | Streptococcus mutans UA159 |
90.306 |
96.552 |
0.872 |
| clpP | Streptococcus thermophilus LMD-9 |
88.776 |
96.552 |
0.857 |
| clpP | Streptococcus thermophilus LMG 18311 |
88.776 |
96.552 |
0.857 |
| clpP | Streptococcus pneumoniae R6 |
89.231 |
96.059 |
0.857 |
| clpP | Streptococcus pneumoniae Rx1 |
89.231 |
96.059 |
0.857 |
| clpP | Streptococcus pneumoniae D39 |
89.231 |
96.059 |
0.857 |
| clpP | Streptococcus pneumoniae TIGR4 |
89.231 |
96.059 |
0.857 |
| clpP | Lactococcus lactis subsp. lactis strain DGCC12653 |
83.756 |
97.044 |
0.813 |
| clpP | Lactococcus lactis subsp. cremoris KW2 |
83.249 |
97.044 |
0.808 |
| clpP | Bacillus subtilis subsp. subtilis str. 168 |
58.163 |
96.552 |
0.562 |
| clpP | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
58.549 |
95.074 |
0.557 |