Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DMC40_RS03570 | Genome accession | NZ_CP029694 |
| Coordinates | 633358..633540 (+) | Length | 60 a.a. |
| NCBI ID | WP_011054793.1 | Uniprot ID | A0A5S4TJP1 |
| Organism | Streptococcus pyogenes strain ABC020055975 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 595570..633540 | 633358..633540 | within | 0 |
Gene organization within MGE regions
Location: 595570..633540
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DMC40_RS03310 (DMC40_03310) | - | 595570..596736 (-) | 1167 | WP_009880742.1 | site-specific integrase | - |
| DMC40_RS03315 (DMC40_03315) | - | 596910..597500 (-) | 591 | WP_009880743.1 | hypothetical protein | - |
| DMC40_RS09770 | - | 597769..597921 (-) | 153 | WP_011054825.1 | hypothetical protein | - |
| DMC40_RS03320 (DMC40_03320) | - | 597932..598309 (-) | 378 | WP_011054824.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DMC40_RS03325 (DMC40_03325) | - | 598293..598652 (-) | 360 | WP_011054823.1 | helix-turn-helix transcriptional regulator | - |
| DMC40_RS03330 (DMC40_03330) | - | 598841..599059 (+) | 219 | WP_009881062.1 | helix-turn-helix transcriptional regulator | - |
| DMC40_RS03335 (DMC40_03335) | - | 599154..599405 (+) | 252 | WP_011054822.1 | hypothetical protein | - |
| DMC40_RS09775 | - | 599436..599573 (+) | 138 | WP_011054821.1 | hypothetical protein | - |
| DMC40_RS03340 (DMC40_03340) | - | 599589..599903 (+) | 315 | WP_011054583.1 | helix-turn-helix transcriptional regulator | - |
| DMC40_RS03345 (DMC40_03345) | - | 600132..600614 (+) | 483 | WP_011054820.1 | siphovirus Gp157 family protein | - |
| DMC40_RS03350 (DMC40_03350) | - | 600615..601295 (+) | 681 | WP_002995975.1 | AAA family ATPase | - |
| DMC40_RS03355 (DMC40_03355) | - | 601397..602626 (+) | 1230 | WP_011054819.1 | DEAD/DEAH box helicase | - |
| DMC40_RS03360 (DMC40_03360) | - | 602642..603100 (+) | 459 | WP_011054580.1 | DUF669 domain-containing protein | - |
| DMC40_RS03365 (DMC40_03365) | - | 603103..603915 (+) | 813 | WP_011106664.1 | bifunctional DNA primase/polymerase | - |
| DMC40_RS03370 (DMC40_03370) | - | 603905..605386 (+) | 1482 | WP_042758230.1 | phage/plasmid primase, P4 family | - |
| DMC40_RS03375 (DMC40_03375) | - | 605631..605951 (+) | 321 | WP_011054817.1 | VRR-NUC domain-containing protein | - |
| DMC40_RS03380 (DMC40_03380) | - | 605935..606291 (+) | 357 | WP_032463301.1 | hypothetical protein | - |
| DMC40_RS10160 (DMC40_03385) | - | 606288..606539 (+) | 252 | WP_032462251.1 | hypothetical protein | - |
| DMC40_RS03390 (DMC40_03390) | - | 606533..606817 (+) | 285 | WP_011018137.1 | DUF3310 domain-containing protein | - |
| DMC40_RS03395 (DMC40_03395) | - | 606814..607227 (+) | 414 | WP_011054815.1 | YopX family protein | - |
| DMC40_RS09780 | - | 607224..607394 (+) | 171 | WP_011054814.1 | hypothetical protein | - |
| DMC40_RS03400 (DMC40_03400) | - | 607391..607675 (+) | 285 | WP_032461310.1 | hypothetical protein | - |
| DMC40_RS03405 (DMC40_03405) | - | 607678..608013 (+) | 336 | WP_011054813.1 | hypothetical protein | - |
| DMC40_RS03410 (DMC40_03410) | - | 608179..608364 (+) | 186 | WP_011054812.1 | hypothetical protein | - |
| DMC40_RS03415 (DMC40_03415) | - | 608651..609154 (+) | 504 | WP_011054811.1 | DUF1642 domain-containing protein | - |
| DMC40_RS09785 | - | 609151..609321 (+) | 171 | WP_002987493.1 | hypothetical protein | - |
| DMC40_RS03425 (DMC40_03425) | - | 609606..610040 (+) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DMC40_RS03430 (DMC40_03430) | - | 610650..611030 (+) | 381 | WP_011285571.1 | hypothetical protein | - |
| DMC40_RS03435 (DMC40_03435) | - | 611020..612294 (+) | 1275 | Protein_607 | PBSX family phage terminase large subunit | - |
| DMC40_RS03440 (DMC40_03440) | - | 612294..613619 (+) | 1326 | WP_032461413.1 | phage portal protein | - |
| DMC40_RS03445 (DMC40_03445) | - | 613588..614496 (+) | 909 | WP_009880264.1 | minor capsid protein | - |
| DMC40_RS03450 (DMC40_03450) | - | 614503..614769 (+) | 267 | WP_011054805.1 | hypothetical protein | - |
| DMC40_RS03455 (DMC40_03455) | - | 614919..615491 (+) | 573 | WP_011054804.1 | DUF4355 domain-containing protein | - |
| DMC40_RS03460 (DMC40_03460) | - | 615509..616399 (+) | 891 | WP_009880261.1 | hypothetical protein | - |
| DMC40_RS03465 (DMC40_03465) | - | 616412..616705 (+) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| DMC40_RS03470 (DMC40_03470) | - | 616719..617063 (+) | 345 | WP_009880259.1 | hypothetical protein | - |
| DMC40_RS03475 (DMC40_03475) | - | 617060..617371 (+) | 312 | WP_009880258.1 | hypothetical protein | - |
| DMC40_RS03480 (DMC40_03480) | - | 617368..617763 (+) | 396 | WP_009880257.1 | hypothetical protein | - |
| DMC40_RS03485 (DMC40_03485) | - | 617765..618175 (+) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| DMC40_RS03490 (DMC40_03490) | - | 618187..618693 (+) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| DMC40_RS03495 (DMC40_03495) | - | 618706..619023 (+) | 318 | WP_009880254.1 | hypothetical protein | - |
| DMC40_RS03500 (DMC40_03500) | - | 618996..619454 (+) | 459 | WP_009880253.1 | hypothetical protein | - |
| DMC40_RS03505 (DMC40_03505) | - | 619447..621252 (+) | 1806 | WP_011054802.1 | tail protein | - |
| DMC40_RS03510 (DMC40_03510) | - | 621253..622737 (+) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| DMC40_RS03515 (DMC40_03515) | - | 622738..626178 (+) | 3441 | WP_011054801.1 | glucosaminidase domain-containing protein | - |
| DMC40_RS03520 (DMC40_03520) | - | 626183..628045 (+) | 1863 | WP_011106671.1 | DUF859 family phage minor structural protein | - |
| DMC40_RS03525 (DMC40_03525) | - | 628056..628403 (+) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| DMC40_RS10085 | - | 628417..628539 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| DMC40_RS03535 (DMC40_03535) | - | 628875..629207 (+) | 333 | WP_011054798.1 | phage holin | - |
| DMC40_RS03540 (DMC40_03540) | - | 629209..629973 (+) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| DMC40_RS03545 (DMC40_03545) | - | 629985..630587 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| DMC40_RS03550 (DMC40_03550) | - | 630598..631371 (+) | 774 | WP_011054795.1 | hypothetical protein | - |
| DMC40_RS03555 (DMC40_03555) | - | 631381..631602 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| DMC40_RS03560 (DMC40_03560) | - | 631602..632261 (+) | 660 | WP_009880240.1 | hypothetical protein | - |
| DMC40_RS03565 (DMC40_03565) | speA | 632383..633138 (-) | 756 | WP_011054794.1 | streptococcal pyrogenic exotoxin SpeA | - |
| DMC40_RS03570 (DMC40_03570) | prx | 633358..633540 (+) | 183 | WP_011054793.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7014.08 Da Isoelectric Point: 4.3313
>NTDB_id=295423 DMC40_RS03570 WP_011054793.1 633358..633540(+) (prx) [Streptococcus pyogenes strain ABC020055975]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=295423 DMC40_RS03570 WP_011054793.1 633358..633540(+) (prx) [Streptococcus pyogenes strain ABC020055975]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS8232 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
68.333 |
100 |
0.683 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |