Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DMC40_RS02980 | Genome accession | NZ_CP029694 |
| Coordinates | 535913..536095 (+) | Length | 60 a.a. |
| NCBI ID | WP_011054856.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain ABC020055975 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 490512..536095 | 535913..536095 | within | 0 |
Gene organization within MGE regions
Location: 490512..536095
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DMC40_RS02720 (DMC40_02720) | fsa | 490512..491156 (+) | 645 | WP_002983569.1 | fructose-6-phosphate aldolase | - |
| DMC40_RS02725 (DMC40_02725) | tkt | 491374..493359 (+) | 1986 | WP_011054904.1 | transketolase | - |
| DMC40_RS02730 (DMC40_02730) | - | 493552..493776 (+) | 225 | WP_011054903.1 | bacteriocin immunity protein | - |
| DMC40_RS02735 (DMC40_02735) | - | 493852..494586 (+) | 735 | WP_011054902.1 | ABC transporter ATP-binding protein | - |
| DMC40_RS02740 (DMC40_02740) | - | 494591..496219 (+) | 1629 | WP_011054901.1 | ABC transporter permease | - |
| DMC40_RS02745 (DMC40_02745) | - | 496362..497450 (-) | 1089 | WP_011054900.1 | site-specific integrase | - |
| DMC40_RS02750 (DMC40_02750) | - | 497626..498177 (-) | 552 | WP_011054899.1 | hypothetical protein | - |
| DMC40_RS02755 (DMC40_02755) | - | 498188..498571 (-) | 384 | WP_011054898.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DMC40_RS02760 (DMC40_02760) | - | 498585..498935 (-) | 351 | WP_011184049.1 | helix-turn-helix transcriptional regulator | - |
| DMC40_RS02765 (DMC40_02765) | - | 499574..499765 (+) | 192 | WP_001283052.1 | hypothetical protein | - |
| DMC40_RS02770 (DMC40_02770) | - | 499816..500016 (+) | 201 | WP_011184050.1 | hypothetical protein | - |
| DMC40_RS02775 (DMC40_02775) | - | 500104..500361 (+) | 258 | WP_011054895.1 | hypothetical protein | - |
| DMC40_RS02780 (DMC40_02780) | - | 500390..500560 (+) | 171 | WP_011054894.1 | hypothetical protein | - |
| DMC40_RS02785 (DMC40_02785) | - | 500553..500760 (+) | 208 | Protein_487 | hypothetical protein | - |
| DMC40_RS02790 (DMC40_02790) | - | 500757..501086 (+) | 330 | WP_050428446.1 | hypothetical protein | - |
| DMC40_RS02795 (DMC40_02795) | - | 501286..501489 (+) | 204 | WP_011054890.1 | hypothetical protein | - |
| DMC40_RS02800 (DMC40_02800) | - | 501577..501876 (+) | 300 | WP_000573833.1 | hypothetical protein | - |
| DMC40_RS02805 (DMC40_02805) | - | 501876..503033 (+) | 1158 | WP_011054889.1 | DUF2800 domain-containing protein | - |
| DMC40_RS02810 (DMC40_02810) | - | 503047..503610 (+) | 564 | WP_011054888.1 | DUF2815 family protein | - |
| DMC40_RS02815 (DMC40_02815) | - | 503653..505575 (+) | 1923 | WP_011054887.1 | DNA polymerase | - |
| DMC40_RS02820 (DMC40_02820) | - | 505580..507964 (+) | 2385 | WP_011054886.1 | phage/plasmid primase, P4 family | - |
| DMC40_RS02825 (DMC40_02825) | - | 508330..508605 (+) | 276 | WP_011054885.1 | VRR-NUC domain-containing protein | - |
| DMC40_RS02830 (DMC40_02830) | - | 508602..509924 (+) | 1323 | WP_011054884.1 | SNF2-related protein | - |
| DMC40_RS09760 | - | 509925..510095 (+) | 171 | WP_011054883.1 | hypothetical protein | - |
| DMC40_RS02835 (DMC40_02835) | - | 510088..510360 (+) | 273 | WP_011054882.1 | hypothetical protein | - |
| DMC40_RS02840 (DMC40_02840) | - | 510493..510909 (+) | 417 | WP_011054881.1 | transcriptional regulator | - |
| DMC40_RS02845 (DMC40_02845) | - | 510999..511451 (+) | 453 | WP_011106637.1 | terminase small subunit | - |
| DMC40_RS02850 (DMC40_02850) | - | 511441..512718 (+) | 1278 | WP_011054879.1 | PBSX family phage terminase large subunit | - |
| DMC40_RS02855 (DMC40_02855) | - | 512734..514266 (+) | 1533 | WP_011106638.1 | phage portal protein | - |
| DMC40_RS02860 (DMC40_02860) | - | 514226..515674 (+) | 1449 | WP_011054877.1 | minor capsid protein | - |
| DMC40_RS02865 (DMC40_02865) | - | 515702..515890 (+) | 189 | WP_011054876.1 | hypothetical protein | - |
| DMC40_RS02870 (DMC40_02870) | - | 515895..516161 (+) | 267 | WP_011054875.1 | hypothetical protein | - |
| DMC40_RS02875 (DMC40_02875) | - | 516329..516898 (+) | 570 | WP_011054874.1 | DUF4355 domain-containing protein | - |
| DMC40_RS02880 (DMC40_02880) | - | 516911..517798 (+) | 888 | WP_002983429.1 | hypothetical protein | - |
| DMC40_RS02885 (DMC40_02885) | - | 517810..518166 (+) | 357 | WP_011054873.1 | phage head-tail connector protein | - |
| DMC40_RS02890 (DMC40_02890) | - | 518177..518455 (+) | 279 | WP_011054872.1 | hypothetical protein | - |
| DMC40_RS02895 (DMC40_02895) | - | 518452..518796 (+) | 345 | WP_011106640.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DMC40_RS02900 (DMC40_02900) | - | 518800..519159 (+) | 360 | WP_011054870.1 | hypothetical protein | - |
| DMC40_RS02905 (DMC40_02905) | - | 519171..519770 (+) | 600 | WP_011054869.1 | phage major tail protein, TP901-1 family | - |
| DMC40_RS02910 (DMC40_02910) | - | 519824..520279 (+) | 456 | WP_011054868.1 | tail assembly chaperone | - |
| DMC40_RS02915 (DMC40_02915) | - | 520354..520587 (+) | 234 | WP_011054867.1 | hypothetical protein | - |
| DMC40_RS02920 (DMC40_02920) | - | 520602..524984 (+) | 4383 | WP_011054866.1 | tape measure protein | - |
| DMC40_RS02925 (DMC40_02925) | - | 524996..525838 (+) | 843 | WP_011054865.1 | phage tail family protein | - |
| DMC40_RS02930 (DMC40_02930) | - | 525848..527827 (+) | 1980 | WP_011054864.1 | phage tail protein | - |
| DMC40_RS02935 (DMC40_02935) | - | 527824..528831 (+) | 1008 | WP_011054441.1 | hyaluronoglucosaminidase | - |
| DMC40_RS02940 (DMC40_02940) | - | 528841..530856 (+) | 2016 | WP_032461307.1 | gp58-like family protein | - |
| DMC40_RS02945 (DMC40_02945) | - | 530868..531305 (+) | 438 | WP_011106643.1 | DUF1617 family protein | - |
| DMC40_RS02950 (DMC40_02950) | - | 531302..531919 (+) | 618 | WP_011184056.1 | DUF1366 domain-containing protein | - |
| DMC40_RS02955 (DMC40_02955) | - | 531929..532201 (+) | 273 | WP_002986916.1 | hypothetical protein | - |
| DMC40_RS02960 (DMC40_02960) | - | 532198..532425 (+) | 228 | WP_003058873.1 | phage holin | - |
| DMC40_RS02965 (DMC40_02965) | - | 532541..533743 (+) | 1203 | WP_011184057.1 | glucosaminidase domain-containing protein | - |
| DMC40_RS02970 (DMC40_02970) | - | 534065..534580 (+) | 516 | WP_023077389.1 | hypothetical protein | - |
| DMC40_RS02975 (DMC40_02975) | - | 534694..535680 (-) | 987 | WP_011106647.1 | DNA/RNA non-specific endonuclease | - |
| DMC40_RS02980 (DMC40_02980) | prx | 535913..536095 (+) | 183 | WP_011054856.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6927.67 Da Isoelectric Point: 3.9286
>NTDB_id=295419 DMC40_RS02980 WP_011054856.1 535913..536095(+) (prx) [Streptococcus pyogenes strain ABC020055975]
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEVVTYENVEEVLRELDK
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEVVTYENVEEVLRELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=295419 DMC40_RS02980 WP_011054856.1 535913..536095(+) (prx) [Streptococcus pyogenes strain ABC020055975]
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGCGACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCGAATGAAGAGGTAAGAAATGGGGAGGTTGTAACATACGAAAATGTGGAAGAAG
TGCTGAGGGAATTAGACAAATAA
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGCGACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCGAATGAAGAGGTAAGAAATGGGGAGGTTGTAACATACGAAAATGTGGAAGAAG
TGCTGAGGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |