Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | DB248_RS06500 | Genome accession | NZ_CP028841 |
| Coordinates | 1223646..1223828 (-) | Length | 60 a.a. |
| NCBI ID | WP_029714291.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain CCUG 4207 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1223646..1257064 | 1223646..1223828 | within | 0 |
Gene organization within MGE regions
Location: 1223646..1257064
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DB248_RS06500 (DB248_06505) | prx | 1223646..1223828 (-) | 183 | WP_029714291.1 | hypothetical protein | Regulator |
| DB248_RS06505 (DB248_06510) | sda3 | 1224057..1224857 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| DB248_RS06510 (DB248_06515) | - | 1225128..1225562 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| DB248_RS06515 (DB248_06520) | - | 1225632..1226837 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| DB248_RS06520 (DB248_06525) | - | 1226953..1227180 (-) | 228 | WP_003058873.1 | phage holin | - |
| DB248_RS06525 (DB248_06530) | - | 1227177..1227452 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| DB248_RS06530 (DB248_06535) | - | 1227462..1228079 (-) | 618 | WP_010922447.1 | DUF1366 domain-containing protein | - |
| DB248_RS06535 (DB248_06540) | - | 1228082..1228513 (-) | 432 | WP_010922448.1 | DUF1617 family protein | - |
| DB248_RS06540 (DB248_06545) | - | 1228525..1230309 (-) | 1785 | WP_010922449.1 | gp58-like family protein | - |
| DB248_RS06545 (DB248_06550) | - | 1230324..1231325 (-) | 1002 | WP_023079488.1 | hyaluronidase HylP | - |
| DB248_RS06550 (DB248_06555) | - | 1231325..1233283 (-) | 1959 | WP_010922451.1 | phage tail spike protein | - |
| DB248_RS06555 (DB248_06560) | - | 1233280..1233975 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| DB248_RS06560 (DB248_06565) | - | 1233972..1236329 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| DB248_RS06565 (DB248_06570) | - | 1236329..1236700 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| DB248_RS06570 (DB248_06575) | - | 1236715..1236978 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| DB248_RS06575 (DB248_06580) | - | 1236989..1237582 (-) | 594 | WP_010922456.1 | tail protein | - |
| DB248_RS06580 (DB248_06585) | - | 1237594..1237929 (-) | 336 | WP_000573598.1 | hypothetical protein | - |
| DB248_RS06585 (DB248_06590) | - | 1237930..1238166 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| DB248_RS06590 (DB248_06595) | - | 1238159..1238497 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| DB248_RS06595 (DB248_06600) | - | 1238457..1238879 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| DB248_RS06600 (DB248_06605) | - | 1238889..1239089 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| DB248_RS06605 (DB248_06610) | - | 1239089..1240000 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| DB248_RS06610 (DB248_06615) | - | 1240025..1240486 (-) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| DB248_RS06615 (DB248_06620) | - | 1240567..1241982 (-) | 1416 | WP_011285619.1 | terminase | - |
| DB248_RS06620 (DB248_06625) | - | 1242092..1242358 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| DB248_RS06625 (DB248_06630) | - | 1242351..1242530 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| DB248_RS06630 (DB248_06635) | - | 1242580..1242804 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| DB248_RS06635 (DB248_06640) | - | 1242810..1244303 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| DB248_RS06640 (DB248_06645) | - | 1244296..1245564 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| DB248_RS06645 (DB248_06650) | - | 1245561..1245917 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| DB248_RS06650 (DB248_06655) | - | 1246066..1246410 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| DB248_RS06655 (DB248_06660) | - | 1246519..1246938 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| DB248_RS06660 (DB248_06665) | - | 1247206..1247841 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| DB248_RS06665 (DB248_06670) | - | 1247843..1248112 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| DB248_RS06670 (DB248_06675) | - | 1248196..1248708 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| DB248_RS06675 (DB248_06680) | - | 1248705..1249046 (-) | 342 | WP_020837403.1 | hypothetical protein | - |
| DB248_RS10145 | - | 1249224..1249391 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| DB248_RS06680 (DB248_06685) | - | 1249401..1250198 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| DB248_RS06685 (DB248_06690) | - | 1250195..1251124 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| DB248_RS06690 (DB248_06695) | - | 1251127..1251456 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| DB248_RS06695 (DB248_06700) | - | 1251512..1251718 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| DB248_RS06700 (DB248_06705) | - | 1251727..1251867 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| DB248_RS06705 (DB248_06710) | - | 1251864..1252097 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| DB248_RS06710 (DB248_06715) | - | 1252078..1252464 (-) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| DB248_RS10350 (DB248_06720) | - | 1252605..1252874 (-) | 270 | WP_011106700.1 | replication protein | - |
| DB248_RS06720 (DB248_06725) | - | 1252968..1253153 (-) | 186 | WP_010922477.1 | hypothetical protein | - |
| DB248_RS06725 (DB248_06730) | - | 1253155..1253466 (-) | 312 | WP_010922478.1 | excisionase | - |
| DB248_RS06730 (DB248_06735) | - | 1253736..1253948 (-) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| DB248_RS06735 (DB248_06740) | - | 1254149..1254904 (+) | 756 | WP_010922480.1 | XRE family transcriptional regulator | - |
| DB248_RS06740 (DB248_06745) | - | 1254916..1255434 (+) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| DB248_RS06745 (DB248_06750) | - | 1255558..1256700 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| DB248_RS06750 (DB248_06755) | - | 1256789..1257064 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6974.02 Da Isoelectric Point: 4.7361
>NTDB_id=288034 DB248_RS06500 WP_029714291.1 1223646..1223828(-) (prx) [Streptococcus pyogenes strain CCUG 4207]
MLTYDEFKQAIDRGYITGDTVMIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDRGYITGDTVMIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=288034 DB248_RS06500 WP_029714291.1 1223646..1223828(-) (prx) [Streptococcus pyogenes strain CCUG 4207]
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
95 |
100 |
0.95 |
| prx | Streptococcus pyogenes MGAS315 |
90 |
100 |
0.9 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
71.667 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |