Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   DA376_RS14915 Genome accession   NZ_CP028437
Coordinates   3016416..3016556 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain DR-08     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3011416..3021556
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DA376_RS14890 (DA376_14890) - 3011762..3012145 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  DA376_RS14895 (DA376_14895) comA 3012167..3012811 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  DA376_RS14900 (DA376_14900) comP 3012892..3015192 (-) 2301 WP_032876801.1 histidine kinase Regulator
  DA376_RS14905 (DA376_14905) comX 3015206..3015379 (-) 174 WP_012118314.1 competence pheromone ComX -
  DA376_RS14910 (DA376_14910) - 3015348..3016208 (-) 861 WP_142925231.1 polyprenyl synthetase family protein -
  DA376_RS14915 (DA376_14915) degQ 3016416..3016556 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  DA376_RS14925 (DA376_14925) - 3017022..3017363 (+) 342 WP_032876795.1 hypothetical protein -
  DA376_RS14930 (DA376_14930) - 3017370..3018593 (-) 1224 WP_032876792.1 EAL and HDOD domain-containing protein -
  DA376_RS14935 (DA376_14935) - 3018723..3020189 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  DA376_RS14940 (DA376_14940) - 3020207..3020758 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  DA376_RS14945 (DA376_14945) - 3020855..3021253 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=284880 DA376_RS14915 WP_003152043.1 3016416..3016556(-) (degQ) [Bacillus velezensis strain DR-08]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=284880 DA376_RS14915 WP_003152043.1 3016416..3016556(-) (degQ) [Bacillus velezensis strain DR-08]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment