Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   C7M25_RS12140 Genome accession   NZ_CP028211
Coordinates   2381220..2381597 (+) Length   125 a.a.
NCBI ID   WP_160223175.1    Uniprot ID   -
Organism   Bacillus velezensis strain SRCM102747     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2376220..2386597
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M25_RS12105 (C7M25_02428) - 2376531..2377481 (+) 951 WP_160223176.1 magnesium transporter CorA family protein -
  C7M25_RS12110 (C7M25_02429) comGA 2377678..2378748 (+) 1071 WP_043020785.1 competence type IV pilus ATPase ComGA Machinery gene
  C7M25_RS12115 (C7M25_02430) comGB 2378735..2379772 (+) 1038 WP_061582071.1 competence type IV pilus assembly protein ComGB Machinery gene
  C7M25_RS12120 (C7M25_02431) comGC 2379819..2380085 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  C7M25_RS12125 (C7M25_02432) comGD 2380075..2380512 (+) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  C7M25_RS12130 (C7M25_02433) comGE 2380496..2380810 (+) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  C7M25_RS12135 (C7M25_02434) comGF 2380719..2381219 (+) 501 WP_257474763.1 competence type IV pilus minor pilin ComGF -
  C7M25_RS12140 (C7M25_02435) comGG 2381220..2381597 (+) 378 WP_160223175.1 competence type IV pilus minor pilin ComGG Machinery gene
  C7M25_RS12145 (C7M25_02436) - 2381654..2381833 (+) 180 WP_160223174.1 YqzE family protein -
  C7M25_RS12150 (C7M25_02437) - 2381873..2382202 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  C7M25_RS12155 (C7M25_02438) tapA 2382461..2383132 (+) 672 WP_160223173.1 amyloid fiber anchoring/assembly protein TapA -
  C7M25_RS12160 (C7M25_02439) sipW 2383104..2383688 (+) 585 WP_160223172.1 signal peptidase I SipW -
  C7M25_RS12165 (C7M25_02440) tasA 2383753..2384538 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  C7M25_RS12170 (C7M25_02441) sinR 2384586..2384921 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  C7M25_RS12175 (C7M25_02442) sinI 2384955..2385128 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  C7M25_RS12180 (C7M25_02443) - 2385305..2386099 (-) 795 WP_076424968.1 YqhG family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14151.14 Da        Isoelectric Point: 10.1580

>NTDB_id=283038 C7M25_RS12140 WP_160223175.1 2381220..2381597(+) (comGG) [Bacillus velezensis strain SRCM102747]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVRTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFAQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=283038 C7M25_RS12140 WP_160223175.1 2381220..2381597(+) (comGG) [Bacillus velezensis strain SRCM102747]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCGAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGCTCAAAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488

Multiple sequence alignment