Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | C9I27_RS07675 | Genome accession | NZ_CP028148 |
| Coordinates | 1483062..1483241 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain TJ11-001 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1475179..1523695 | 1483062..1483241 | within | 0 |
Gene organization within MGE regions
Location: 1475179..1523695
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C9I27_RS07635 | - | 1475179..1475613 (-) | 435 | WP_002988824.1 | CopY/TcrY family copper transport repressor | - |
| C9I27_RS07640 | - | 1475797..1476774 (+) | 978 | WP_223845213.1 | alpha/beta hydrolase fold domain-containing protein | - |
| C9I27_RS07645 | rbfA | 1476905..1477255 (-) | 351 | WP_002988820.1 | 30S ribosome-binding factor RbfA | - |
| C9I27_RS07650 | infB | 1477461..1480322 (-) | 2862 | WP_002983491.1 | translation initiation factor IF-2 | - |
| C9I27_RS07655 | - | 1480342..1480644 (-) | 303 | WP_002983488.1 | YlxQ-related RNA-binding protein | - |
| C9I27_RS07660 | rnpM | 1480637..1480933 (-) | 297 | WP_002983486.1 | RNase P modulator RnpM | - |
| C9I27_RS07665 | nusA | 1480949..1482106 (-) | 1158 | WP_002988817.1 | transcription termination factor NusA | - |
| C9I27_RS07670 | rimP | 1482281..1482817 (-) | 537 | WP_002988815.1 | ribosome maturation factor RimP | - |
| C9I27_RS07675 | prx | 1483062..1483241 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| C9I27_RS07680 | sda1 | 1483480..1484652 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| C9I27_RS07685 | - | 1484768..1485964 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| C9I27_RS07690 | - | 1486091..1486276 (-) | 186 | WP_002988802.1 | holin | - |
| C9I27_RS07695 | - | 1486273..1486572 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| C9I27_RS07700 | - | 1486583..1487203 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| C9I27_RS07705 | - | 1487206..1487367 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| C9I27_RS07710 | - | 1487376..1489283 (-) | 1908 | WP_038433824.1 | gp58-like family protein | - |
| C9I27_RS07715 | - | 1489294..1489929 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| C9I27_RS07720 | - | 1489929..1490984 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| C9I27_RS07725 | - | 1490981..1492963 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| C9I27_RS07730 | - | 1492973..1493815 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| C9I27_RS07735 | - | 1493827..1498209 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| C9I27_RS07740 | - | 1498224..1498457 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| C9I27_RS07745 | - | 1498532..1498987 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| C9I27_RS07750 | - | 1499041..1499640 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| C9I27_RS07755 | - | 1499652..1500011 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| C9I27_RS07760 | - | 1500015..1500359 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| C9I27_RS07765 | - | 1500356..1500634 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| C9I27_RS07770 | - | 1500645..1501001 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| C9I27_RS07775 | - | 1501013..1501900 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| C9I27_RS07780 | - | 1501913..1502482 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| C9I27_RS07785 | - | 1502638..1502904 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| C9I27_RS07790 | - | 1502907..1503095 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| C9I27_RS07795 | - | 1503126..1504571 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| C9I27_RS07800 | - | 1504531..1506063 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| C9I27_RS07805 | - | 1506079..1507356 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| C9I27_RS07810 | - | 1507346..1507798 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| C9I27_RS07815 | - | 1507888..1508304 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| C9I27_RS07820 | - | 1508301..1508492 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| C9I27_RS07825 | - | 1508482..1509333 (-) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| C9I27_RS07830 | - | 1509342..1509608 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| C9I27_RS10060 | - | 1509605..1509772 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| C9I27_RS07835 | - | 1509773..1511095 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| C9I27_RS07840 | - | 1511092..1511367 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| C9I27_RS07845 | - | 1511754..1514138 (-) | 2385 | WP_002988726.1 | phage/plasmid primase, P4 family | - |
| C9I27_RS07850 | - | 1514143..1516065 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| C9I27_RS07855 | - | 1516108..1516665 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| C9I27_RS07860 | - | 1516676..1517074 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| C9I27_RS07865 | - | 1517078..1518232 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| C9I27_RS07870 | - | 1518232..1518531 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| C9I27_RS07875 | - | 1518619..1518822 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| C9I27_RS07880 | - | 1518969..1519355 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| C9I27_RS07885 | - | 1519352..1519555 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| C9I27_RS07890 | - | 1519548..1519718 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| C9I27_RS07895 | - | 1519715..1519990 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| C9I27_RS07900 | - | 1520052..1520267 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| C9I27_RS07905 | - | 1520315..1520728 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| C9I27_RS10065 | - | 1520709..1520864 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| C9I27_RS07910 | - | 1521139..1521540 (+) | 402 | WP_011285676.1 | helix-turn-helix domain-containing protein | - |
| C9I27_RS07915 | - | 1521554..1521937 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| C9I27_RS07920 | - | 1521948..1522499 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| C9I27_RS07925 | - | 1522616..1523695 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=281705 C9I27_RS07675 WP_002988813.1 1483062..1483241(-) (prx) [Streptococcus pyogenes strain TJ11-001]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=281705 C9I27_RS07675 WP_002988813.1 1483062..1483241(-) (prx) [Streptococcus pyogenes strain TJ11-001]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |