Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | C9I27_RS06365 | Genome accession | NZ_CP028148 |
| Coordinates | 1234076..1234258 (-) | Length | 60 a.a. |
| NCBI ID | WP_011528776.1 | Uniprot ID | A0A660A5W9 |
| Organism | Streptococcus pyogenes strain TJ11-001 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1234076..1277064 | 1234076..1234258 | within | 0 |
Gene organization within MGE regions
Location: 1234076..1277064
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C9I27_RS06365 | prx | 1234076..1234258 (-) | 183 | WP_011528776.1 | hypothetical protein | Regulator |
| C9I27_RS06370 | entC3 | 1234371..1235153 (-) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| C9I27_RS06375 | - | 1235401..1236525 (-) | 1125 | WP_002988467.1 | Fic family protein | - |
| C9I27_RS06380 | - | 1236661..1237878 (-) | 1218 | WP_011528778.1 | peptidoglycan amidohydrolase family protein | - |
| C9I27_RS06385 | - | 1237997..1238224 (-) | 228 | WP_003058873.1 | phage holin | - |
| C9I27_RS06390 | - | 1238221..1238493 (-) | 273 | WP_019418840.1 | hypothetical protein | - |
| C9I27_RS06395 | - | 1238503..1239120 (-) | 618 | WP_011017592.1 | DUF1366 domain-containing protein | - |
| C9I27_RS06400 | - | 1239123..1239554 (-) | 432 | WP_002983467.1 | DUF1617 family protein | - |
| C9I27_RS06405 | - | 1239566..1241476 (-) | 1911 | WP_038433819.1 | gp58-like family protein | - |
| C9I27_RS06410 | - | 1241487..1242122 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| C9I27_RS06415 | - | 1242122..1243177 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| C9I27_RS06420 | - | 1243174..1245321 (-) | 2148 | WP_038433820.1 | phage tail spike protein | - |
| C9I27_RS06425 | - | 1245318..1246025 (-) | 708 | WP_011527559.1 | distal tail protein Dit | - |
| C9I27_RS06430 | - | 1246025..1249948 (-) | 3924 | WP_011527558.1 | phage tail tape measure protein | - |
| C9I27_RS10035 | - | 1249961..1250110 (-) | 150 | WP_021299462.1 | hypothetical protein | - |
| C9I27_RS06435 | gpG | 1250158..1250484 (-) | 327 | WP_011017586.1 | phage tail assembly chaperone G | - |
| C9I27_RS06440 | - | 1250537..1251145 (-) | 609 | WP_011017585.1 | major tail protein | - |
| C9I27_RS06445 | - | 1251161..1251586 (-) | 426 | WP_011017584.1 | hypothetical protein | - |
| C9I27_RS06450 | - | 1251583..1251960 (-) | 378 | WP_011527557.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| C9I27_RS06455 | - | 1251957..1252304 (-) | 348 | WP_011017582.1 | phage head closure protein | - |
| C9I27_RS06460 | - | 1252301..1252603 (-) | 303 | WP_011017581.1 | head-tail connector protein | - |
| C9I27_RS10245 | - | 1252606..1252734 (-) | 129 | WP_001118388.1 | hypothetical protein | - |
| C9I27_RS06465 | - | 1252748..1253935 (-) | 1188 | WP_011017580.1 | phage major capsid protein | - |
| C9I27_RS06470 | - | 1253960..1254625 (-) | 666 | WP_011017579.1 | head maturation protease, ClpP-related | - |
| C9I27_RS06475 | - | 1254603..1255823 (-) | 1221 | WP_011017578.1 | phage portal protein | - |
| C9I27_RS06480 | - | 1255857..1256081 (-) | 225 | WP_002985363.1 | hypothetical protein | - |
| C9I27_RS10040 | - | 1256074..1256244 (-) | 171 | WP_002985365.1 | hypothetical protein | - |
| C9I27_RS06485 | - | 1256241..1257995 (-) | 1755 | WP_024623442.1 | terminase large subunit | - |
| C9I27_RS06490 | - | 1257999..1258229 (-) | 231 | WP_002985368.1 | hypothetical protein | - |
| C9I27_RS06495 | - | 1258232..1258699 (-) | 468 | WP_002985371.1 | phage terminase small subunit P27 family | - |
| C9I27_RS06500 | - | 1258870..1259207 (-) | 338 | Protein_1207 | HNH endonuclease | - |
| C9I27_RS06510 | - | 1259443..1259628 (+) | 186 | WP_001132273.1 | type II toxin-antitoxin system HicA family toxin | - |
| C9I27_RS06515 | - | 1259680..1260057 (+) | 378 | WP_002987543.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| C9I27_RS06520 | - | 1260184..1261149 (-) | 966 | WP_019418843.1 | DNA adenine methylase | - |
| C9I27_RS06525 | - | 1261732..1262169 (-) | 438 | WP_011017574.1 | DUF1492 domain-containing protein | - |
| C9I27_RS10045 | - | 1262445..1262615 (-) | 171 | WP_002987493.1 | hypothetical protein | - |
| C9I27_RS06535 | - | 1262612..1263337 (-) | 726 | WP_011017573.1 | DUF1642 domain-containing protein | - |
| C9I27_RS06540 | - | 1263385..1264149 (-) | 765 | WP_021299463.1 | site-specific DNA-methyltransferase | - |
| C9I27_RS06545 | - | 1264139..1264621 (-) | 483 | WP_011017571.1 | class I SAM-dependent methyltransferase | - |
| C9I27_RS06550 | - | 1264625..1264909 (-) | 285 | WP_011017570.1 | hypothetical protein | - |
| C9I27_RS06555 | - | 1264906..1265319 (-) | 414 | WP_011017569.1 | YopX family protein | - |
| C9I27_RS06560 | - | 1265329..1265598 (-) | 270 | WP_002987593.1 | hypothetical protein | - |
| C9I27_RS06565 | - | 1265595..1265780 (-) | 186 | WP_011527551.1 | hypothetical protein | - |
| C9I27_RS06570 | - | 1265773..1266054 (-) | 282 | WP_011527550.1 | nucleotide modification associated domain-containing protein | - |
| C9I27_RS06575 | - | 1266179..1266535 (-) | 357 | WP_011527549.1 | hypothetical protein | - |
| C9I27_RS06580 | - | 1266519..1266839 (-) | 321 | WP_011527548.1 | VRR-NUC domain-containing protein | - |
| C9I27_RS06585 | - | 1266836..1267249 (-) | 414 | WP_011527547.1 | hypothetical protein | - |
| C9I27_RS06590 | - | 1267511..1268986 (-) | 1476 | WP_107114778.1 | phage/plasmid primase, P4 family | - |
| C9I27_RS06595 | - | 1268976..1269788 (-) | 813 | WP_011527545.1 | bifunctional DNA primase/polymerase | - |
| C9I27_RS06600 | - | 1269791..1270249 (-) | 459 | WP_011527544.1 | DUF669 domain-containing protein | - |
| C9I27_RS06605 | - | 1270265..1271494 (-) | 1230 | WP_026031990.1 | DEAD/DEAH box helicase | - |
| C9I27_RS06610 | - | 1271596..1272288 (-) | 693 | WP_011527542.1 | AAA family ATPase | - |
| C9I27_RS06615 | - | 1272275..1272565 (-) | 291 | WP_024623417.1 | hypothetical protein | - |
| C9I27_RS06620 | - | 1272696..1272878 (-) | 183 | WP_008087492.1 | hypothetical protein | - |
| C9I27_RS06625 | - | 1272866..1273078 (-) | 213 | WP_011527540.1 | hypothetical protein | - |
| C9I27_RS10050 | - | 1273088..1273228 (-) | 141 | WP_011527539.1 | hypothetical protein | - |
| C9I27_RS06630 | - | 1273225..1273470 (-) | 246 | WP_011527538.1 | hypothetical protein | - |
| C9I27_RS06635 | - | 1273735..1273947 (-) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| C9I27_RS06640 | - | 1274149..1274904 (+) | 756 | WP_010922480.1 | XRE family transcriptional regulator | - |
| C9I27_RS06645 | - | 1274916..1275434 (+) | 519 | WP_011528799.1 | HIRAN domain-containing protein | - |
| C9I27_RS06650 | - | 1275558..1276700 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| C9I27_RS06655 | - | 1276789..1277064 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6840.81 Da Isoelectric Point: 4.7023
>NTDB_id=281698 C9I27_RS06365 WP_011528776.1 1234076..1234258(-) (prx) [Streptococcus pyogenes strain TJ11-001]
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=281698 C9I27_RS06365 WP_011528776.1 1234076..1234258(-) (prx) [Streptococcus pyogenes strain TJ11-001]
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
81.395 |
71.667 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |