Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | C5P47_RS05670 | Genome accession | NZ_CP028140 |
| Coordinates | 1122704..1122886 (-) | Length | 60 a.a. |
| NCBI ID | WP_011184726.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NGAS979 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1122704..1165050 | 1122704..1122886 | within | 0 |
Gene organization within MGE regions
Location: 1122704..1165050
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C5P47_RS05670 (C5P47_05655) | prx | 1122704..1122886 (-) | 183 | WP_011184726.1 | hypothetical protein | Regulator |
| C5P47_RS05675 (C5P47_05660) | mf2 | 1123126..1123884 (+) | 759 | WP_011184727.1 | DNase Mf2 | - |
| C5P47_RS05680 (C5P47_05665) | speC | 1123995..1124702 (+) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| C5P47_RS05685 (C5P47_05670) | - | 1124771..1125523 (-) | 753 | WP_110410808.1 | CHAP domain-containing protein | - |
| C5P47_RS05690 (C5P47_05675) | - | 1125525..1125857 (-) | 333 | WP_021733507.1 | phage holin | - |
| C5P47_RS05695 (C5P47_05680) | - | 1125870..1126190 (-) | 321 | WP_021733504.1 | hypothetical protein | - |
| C5P47_RS05700 (C5P47_05685) | - | 1126201..1126812 (-) | 612 | WP_110410809.1 | DUF1366 domain-containing protein | - |
| C5P47_RS05705 (C5P47_05690) | - | 1126815..1126976 (-) | 162 | WP_080465067.1 | hypothetical protein | - |
| C5P47_RS05710 (C5P47_05695) | - | 1126990..1128900 (-) | 1911 | WP_110410810.1 | gp58-like family protein | - |
| C5P47_RS05715 (C5P47_05700) | - | 1128916..1130031 (-) | 1116 | WP_063629795.1 | hyaluronoglucosaminidase | - |
| C5P47_RS05720 (C5P47_05705) | - | 1130028..1132079 (-) | 2052 | WP_110410811.1 | phage tail spike protein | - |
| C5P47_RS05725 (C5P47_05710) | - | 1132076..1132855 (-) | 780 | WP_032460156.1 | distal tail protein Dit | - |
| C5P47_RS05730 (C5P47_05715) | - | 1132887..1136522 (-) | 3636 | WP_032460157.1 | tape measure protein | - |
| C5P47_RS05735 (C5P47_05720) | - | 1136537..1136866 (-) | 330 | WP_011017851.1 | hypothetical protein | - |
| C5P47_RS05740 (C5P47_05725) | - | 1136908..1137255 (-) | 348 | WP_338141289.1 | tail assembly chaperone | - |
| C5P47_RS05745 (C5P47_05730) | - | 1137319..1137942 (-) | 624 | WP_032460160.1 | phage major tail protein, TP901-1 family | - |
| C5P47_RS05750 (C5P47_05735) | - | 1137958..1138347 (-) | 390 | WP_032460161.1 | phage capsid protein | - |
| C5P47_RS05755 (C5P47_05740) | - | 1138344..1138709 (-) | 366 | WP_002984399.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| C5P47_RS05760 (C5P47_05745) | - | 1138690..1138998 (-) | 309 | WP_002984393.1 | hypothetical protein | - |
| C5P47_RS05765 (C5P47_05750) | - | 1138995..1139348 (-) | 354 | WP_032460162.1 | phage head-tail connector protein | - |
| C5P47_RS05770 (C5P47_05755) | - | 1139362..1139604 (-) | 243 | WP_032460163.1 | HeH/LEM domain-containing protein | - |
| C5P47_RS05775 (C5P47_05760) | - | 1139614..1140687 (-) | 1074 | WP_110410812.1 | major capsid protein | - |
| C5P47_RS05780 (C5P47_05765) | - | 1140690..1141058 (-) | 369 | WP_110410813.1 | head decoration protein | - |
| C5P47_RS05785 (C5P47_05770) | - | 1141068..1141601 (-) | 534 | WP_032460165.1 | DUF4355 domain-containing protein | - |
| C5P47_RS05790 (C5P47_05775) | - | 1141745..1142011 (-) | 267 | WP_032460166.1 | hypothetical protein | - |
| C5P47_RS05795 (C5P47_05780) | - | 1142071..1142256 (-) | 186 | WP_306452438.1 | hypothetical protein | - |
| C5P47_RS05800 (C5P47_05785) | - | 1142241..1143866 (-) | 1626 | WP_110410814.1 | minor capsid protein | - |
| C5P47_RS05805 (C5P47_05790) | - | 1143847..1145346 (-) | 1500 | WP_032460168.1 | phage portal protein | - |
| C5P47_RS05810 (C5P47_05795) | - | 1145358..1146602 (-) | 1245 | WP_032460169.1 | PBSX family phage terminase large subunit | - |
| C5P47_RS05815 (C5P47_05800) | - | 1146599..1147048 (-) | 450 | WP_227868753.1 | hypothetical protein | - |
| C5P47_RS05820 (C5P47_05805) | - | 1147390..1148556 (-) | 1167 | WP_032464460.1 | DNA modification methylase | - |
| C5P47_RS05825 (C5P47_05810) | - | 1148863..1149303 (-) | 441 | WP_002990052.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| C5P47_RS05830 (C5P47_05815) | - | 1149674..1149967 (-) | 294 | WP_110410815.1 | hypothetical protein | - |
| C5P47_RS05835 (C5P47_05820) | - | 1149964..1150149 (-) | 186 | WP_011054812.1 | hypothetical protein | - |
| C5P47_RS05840 (C5P47_05825) | - | 1150174..1150362 (-) | 189 | WP_032460173.1 | hypothetical protein | - |
| C5P47_RS05845 (C5P47_05830) | - | 1150365..1150700 (-) | 336 | WP_011054813.1 | hypothetical protein | - |
| C5P47_RS05850 (C5P47_05835) | - | 1150703..1150987 (-) | 285 | WP_032460174.1 | hypothetical protein | - |
| C5P47_RS09125 | - | 1150984..1151154 (-) | 171 | WP_164977039.1 | hypothetical protein | - |
| C5P47_RS05855 (C5P47_05840) | - | 1151151..1151564 (-) | 414 | WP_011054815.1 | YopX family protein | - |
| C5P47_RS05860 (C5P47_05845) | - | 1151561..1151845 (-) | 285 | WP_011018137.1 | DUF3310 domain-containing protein | - |
| C5P47_RS09385 (C5P47_05850) | - | 1151839..1152090 (-) | 252 | WP_011106665.1 | hypothetical protein | - |
| C5P47_RS05870 (C5P47_05855) | - | 1152087..1152443 (-) | 357 | WP_011018138.1 | hypothetical protein | - |
| C5P47_RS05875 (C5P47_05860) | - | 1152440..1152880 (-) | 441 | WP_032460175.1 | RusA family crossover junction endodeoxyribonuclease | - |
| C5P47_RS05880 (C5P47_05865) | - | 1152880..1153083 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| C5P47_RS05885 (C5P47_05870) | ssbA | 1153089..1153508 (-) | 420 | WP_032460176.1 | single-stranded DNA-binding protein | Machinery gene |
| C5P47_RS05890 (C5P47_05875) | - | 1153501..1154175 (-) | 675 | WP_023078248.1 | ERF family protein | - |
| C5P47_RS05895 (C5P47_05880) | - | 1154176..1154658 (-) | 483 | WP_021341163.1 | siphovirus Gp157 family protein | - |
| C5P47_RS05900 (C5P47_05885) | - | 1154679..1154933 (-) | 255 | WP_032460177.1 | hypothetical protein | - |
| C5P47_RS05905 (C5P47_05890) | - | 1154914..1155270 (-) | 357 | WP_021341157.1 | HTH domain-containing protein | - |
| C5P47_RS09130 | - | 1155281..1155418 (-) | 138 | WP_011018145.1 | hypothetical protein | - |
| C5P47_RS05910 (C5P47_05895) | - | 1155409..1156191 (-) | 783 | WP_032460178.1 | ATP-binding protein | - |
| C5P47_RS05915 (C5P47_05900) | - | 1156178..1156939 (-) | 762 | WP_014635613.1 | DnaD domain protein | - |
| C5P47_RS05920 (C5P47_05905) | - | 1157033..1157170 (-) | 138 | WP_011017881.1 | hypothetical protein | - |
| C5P47_RS05925 (C5P47_05910) | - | 1157172..1157339 (-) | 168 | Protein_1096 | excisionase | - |
| C5P47_RS05930 (C5P47_05915) | - | 1157452..1157811 (-) | 360 | WP_012560976.1 | hypothetical protein | - |
| C5P47_RS05935 (C5P47_05920) | - | 1157887..1158198 (-) | 312 | WP_014411880.1 | hypothetical protein | - |
| C5P47_RS05940 (C5P47_05925) | - | 1158277..1158462 (-) | 186 | WP_046176892.1 | helix-turn-helix transcriptional regulator | - |
| C5P47_RS05945 (C5P47_05930) | - | 1158606..1158920 (+) | 315 | WP_032461901.1 | hypothetical protein | - |
| C5P47_RS05950 (C5P47_05935) | - | 1158895..1159245 (-) | 351 | WP_110410816.1 | hypothetical protein | - |
| C5P47_RS05955 (C5P47_05940) | - | 1159249..1159971 (-) | 723 | WP_032460391.1 | phage antirepressor KilAC domain-containing protein | - |
| C5P47_RS05960 (C5P47_05945) | - | 1160022..1160249 (-) | 228 | WP_002990088.1 | hypothetical protein | - |
| C5P47_RS05965 (C5P47_05950) | - | 1160409..1161167 (+) | 759 | WP_110410817.1 | S24 family peptidase | - |
| C5P47_RS05970 (C5P47_05955) | - | 1161202..1161882 (+) | 681 | WP_002990092.1 | hypothetical protein | - |
| C5P47_RS05975 (C5P47_05960) | - | 1162019..1163161 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| C5P47_RS05980 (C5P47_05965) | - | 1163251..1163526 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| C5P47_RS05985 (C5P47_05970) | - | 1163625..1164212 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| C5P47_RS05990 (C5P47_05975) | - | 1164190..1165032 (-) | 843 | WP_011888746.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6936.91 Da Isoelectric Point: 4.1954
>NTDB_id=281597 C5P47_RS05670 WP_011184726.1 1122704..1122886(-) (prx) [Streptococcus pyogenes strain NGAS979]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=281597 C5P47_RS05670 WP_011184726.1 1122704..1122886(-) (prx) [Streptococcus pyogenes strain NGAS979]
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS8232 |
86.667 |
100 |
0.867 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
70 |
0.5 |