Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | C7K40_RS02155 | Genome accession | NZ_CP027771 |
| Coordinates | 383153..383335 (+) | Length | 60 a.a. |
| NCBI ID | WP_011184907.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain DMG1800716 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 321952..388075 | 383153..383335 | within | 0 |
Gene organization within MGE regions
Location: 321952..388075
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C7K40_RS01760 (C7K40_01760) | - | 321952..322848 (-) | 897 | WP_021299026.1 | sulfite exporter TauE/SafE family protein | - |
| C7K40_RS01765 (C7K40_01765) | - | 323146..323898 (+) | 753 | WP_002983053.1 | CppA N-terminal domain-containing protein | - |
| C7K40_RS01770 (C7K40_01770) | - | 323883..324833 (+) | 951 | WP_080262145.1 | serine hydrolase domain-containing protein | - |
| C7K40_RS01775 (C7K40_01775) | pflB | 325013..327340 (-) | 2328 | WP_002988233.1 | formate C-acetyltransferase | - |
| C7K40_RS01780 (C7K40_01780) | dinB | 327549..328643 (+) | 1095 | WP_023613138.1 | DNA polymerase IV | - |
| C7K40_RS01785 (C7K40_01785) | - | 328736..329218 (-) | 483 | WP_023613151.1 | hypothetical protein | - |
| C7K40_RS01790 (C7K40_01790) | - | 329287..331761 (-) | 2475 | WP_023613150.1 | ATP-dependent RecD-like DNA helicase | - |
| C7K40_RS01795 (C7K40_01795) | lepB | 331819..332412 (-) | 594 | WP_002983074.1 | signal peptidase I | - |
| C7K40_RS01800 (C7K40_01800) | rnhC | 332423..333325 (-) | 903 | WP_063629657.1 | ribonuclease HIII | - |
| C7K40_RS01805 (C7K40_01805) | - | 333482..333790 (+) | 309 | WP_002993251.1 | hypothetical protein | - |
| C7K40_RS01810 (C7K40_01810) | - | 333793..334338 (+) | 546 | WP_002993250.1 | CvpA family protein | - |
| C7K40_RS01815 (C7K40_01815) | - | 334487..336826 (+) | 2340 | WP_023613147.1 | endonuclease MutS2 | - |
| C7K40_RS01820 (C7K40_01820) | - | 336830..337330 (+) | 501 | WP_023613146.1 | phosphatase PAP2 family protein | - |
| C7K40_RS01825 (C7K40_01825) | trxA | 337393..337725 (+) | 333 | WP_258850450.1 | thioredoxin | - |
| C7K40_RS01830 (C7K40_01830) | - | 337777..338364 (-) | 588 | WP_023613156.1 | helix-turn-helix transcriptional regulator | - |
| C7K40_RS01835 (C7K40_01835) | mutY | 338541..339695 (-) | 1155 | WP_023613149.1 | A/G-specific adenine glycosylase | - |
| C7K40_RS01840 (C7K40_01840) | - | 339863..340156 (+) | 294 | WP_002983113.1 | hypothetical protein | - |
| C7K40_RS01845 (C7K40_01845) | rpsF | 340329..340619 (+) | 291 | WP_002983117.1 | 30S ribosomal protein S6 | - |
| C7K40_RS01850 (C7K40_01850) | ssb | 340641..341132 (+) | 492 | WP_002983122.1 | single-stranded DNA-binding protein | Machinery gene |
| C7K40_RS01855 (C7K40_01855) | rpsR | 341297..341536 (+) | 240 | WP_002983142.1 | 30S ribosomal protein S18 | - |
| C7K40_RS01860 (C7K40_01860) | - | 341669..342325 (-) | 657 | WP_023610581.1 | DUF1129 domain-containing protein | - |
| C7K40_RS01865 (C7K40_01865) | - | 342457..343401 (-) | 945 | WP_002983147.1 | magnesium transporter CorA family protein | - |
| C7K40_RS01870 (C7K40_01870) | - | 343645..344742 (-) | 1098 | WP_042361562.1 | site-specific integrase | - |
| C7K40_RS01875 (C7K40_01875) | - | 344918..345439 (-) | 522 | WP_020837688.1 | hypothetical protein | - |
| C7K40_RS01880 (C7K40_01880) | - | 345450..345830 (-) | 381 | WP_002986894.1 | ImmA/IrrE family metallo-endopeptidase | - |
| C7K40_RS01885 (C7K40_01885) | - | 345844..346203 (-) | 360 | WP_011054768.1 | helix-turn-helix transcriptional regulator | - |
| C7K40_RS01890 (C7K40_01890) | - | 346622..346717 (-) | 96 | WP_020837683.1 | type I toxin-antitoxin system Fst family toxin | - |
| C7K40_RS01895 (C7K40_01895) | - | 347352..347543 (+) | 192 | WP_020837679.1 | hypothetical protein | - |
| C7K40_RS01900 (C7K40_01900) | - | 347555..348271 (+) | 717 | WP_063629658.1 | phage antirepressor KilAC domain-containing protein | - |
| C7K40_RS09445 | - | 348304..348453 (+) | 150 | WP_002986888.1 | hypothetical protein | - |
| C7K40_RS01905 (C7K40_01905) | - | 348450..348650 (-) | 201 | WP_002986887.1 | KTSC domain-containing protein | - |
| C7K40_RS01910 (C7K40_01910) | - | 348726..348893 (+) | 168 | WP_002986885.1 | hypothetical protein | - |
| C7K40_RS01920 (C7K40_01920) | - | 349139..349396 (+) | 258 | WP_002988339.1 | hypothetical protein | - |
| C7K40_RS01925 (C7K40_01925) | - | 349425..349610 (+) | 186 | WP_063629659.1 | hypothetical protein | - |
| C7K40_RS01930 (C7K40_01930) | - | 349704..349961 (+) | 258 | WP_019418742.1 | hypothetical protein | - |
| C7K40_RS01935 (C7K40_01935) | - | 350083..350496 (+) | 414 | WP_172456386.1 | DnaD domain protein | - |
| C7K40_RS01940 (C7K40_01940) | - | 350477..350710 (+) | 234 | WP_002985387.1 | hypothetical protein | - |
| C7K40_RS01945 (C7K40_01945) | - | 350707..350847 (+) | 141 | WP_011017992.1 | hypothetical protein | - |
| C7K40_RS01950 (C7K40_01950) | - | 350856..351062 (+) | 207 | WP_011017565.1 | hypothetical protein | - |
| C7K40_RS01955 (C7K40_01955) | - | 351118..351450 (+) | 333 | WP_010922475.1 | hypothetical protein | - |
| C7K40_RS01960 (C7K40_01960) | - | 351450..352439 (+) | 990 | WP_063629661.1 | recombinase RecT | - |
| C7K40_RS01965 (C7K40_01965) | - | 352436..352636 (+) | 201 | WP_010922473.1 | hypothetical protein | - |
| C7K40_RS01970 (C7K40_01970) | - | 352629..353426 (+) | 798 | WP_020837672.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| C7K40_RS01975 (C7K40_01975) | - | 353602..353940 (+) | 339 | WP_002990067.1 | hypothetical protein | - |
| C7K40_RS01980 (C7K40_01980) | - | 353937..354449 (+) | 513 | WP_010922210.1 | hypothetical protein | - |
| C7K40_RS01985 (C7K40_01985) | - | 354436..354630 (+) | 195 | WP_063629662.1 | hypothetical protein | - |
| C7K40_RS01990 (C7K40_01990) | - | 354627..354896 (+) | 270 | WP_002993802.1 | hypothetical protein | - |
| C7K40_RS01995 (C7K40_01995) | - | 354898..355530 (+) | 633 | WP_063629663.1 | N-6 DNA methylase | - |
| C7K40_RS02000 (C7K40_02000) | - | 355929..356366 (+) | 438 | WP_011017574.1 | DUF1492 domain-containing protein | - |
| C7K40_RS02005 (C7K40_02005) | - | 356528..357694 (+) | 1167 | WP_019418850.1 | DNA modification methylase | - |
| C7K40_RS02010 (C7K40_02010) | - | 358037..358513 (+) | 477 | WP_010922073.1 | hypothetical protein | - |
| C7K40_RS02015 (C7K40_02015) | - | 358516..359807 (+) | 1292 | Protein_337 | PBSX family phage terminase large subunit | - |
| C7K40_RS02020 (C7K40_02020) | - | 359821..361323 (+) | 1503 | WP_080465144.1 | phage portal protein | - |
| C7K40_RS02025 (C7K40_02025) | - | 361328..362806 (+) | 1479 | WP_063629665.1 | phage minor capsid protein | - |
| C7K40_RS02030 (C7K40_02030) | - | 362778..363017 (+) | 240 | WP_002986829.1 | hypothetical protein | - |
| C7K40_RS02035 (C7K40_02035) | - | 363079..363345 (+) | 267 | WP_011054745.1 | hypothetical protein | - |
| C7K40_RS02040 (C7K40_02040) | - | 363471..364085 (+) | 615 | WP_011106689.1 | hypothetical protein | - |
| C7K40_RS02045 (C7K40_02045) | - | 364089..364907 (+) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| C7K40_RS02050 (C7K40_02050) | - | 364961..365377 (+) | 417 | WP_010922081.1 | hypothetical protein | - |
| C7K40_RS02055 (C7K40_02055) | - | 365367..365699 (+) | 333 | WP_011888693.1 | minor capsid protein | - |
| C7K40_RS02060 (C7K40_02060) | - | 365699..366055 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| C7K40_RS02065 (C7K40_02065) | - | 366052..366450 (+) | 399 | WP_063629666.1 | minor capsid protein | - |
| C7K40_RS02070 (C7K40_02070) | - | 366450..366911 (+) | 462 | WP_011018120.1 | hypothetical protein | - |
| C7K40_RS02075 (C7K40_02075) | - | 366921..367355 (+) | 435 | WP_011888695.1 | hypothetical protein | - |
| C7K40_RS02080 (C7K40_02080) | - | 367359..367940 (+) | 582 | WP_011888696.1 | bacteriophage Gp15 family protein | - |
| C7K40_RS02085 (C7K40_02085) | - | 367930..371148 (+) | 3219 | WP_063629667.1 | tape measure protein | - |
| C7K40_RS02090 (C7K40_02090) | - | 371187..371903 (+) | 717 | WP_010922089.1 | distal tail protein Dit | - |
| C7K40_RS02095 (C7K40_02095) | - | 371900..374044 (+) | 2145 | WP_021775334.1 | phage tail spike protein | - |
| C7K40_RS02100 (C7K40_02100) | hylP | 374041..375054 (+) | 1014 | WP_063629668.1 | hyaluronidase HylP | - |
| C7K40_RS02105 (C7K40_02105) | - | 375069..376955 (+) | 1887 | WP_063629669.1 | gp58-like family protein | - |
| C7K40_RS02110 (C7K40_02110) | - | 376967..377395 (+) | 429 | WP_023079239.1 | DUF1617 family protein | - |
| C7K40_RS02115 (C7K40_02115) | - | 377398..378015 (+) | 618 | WP_063629670.1 | DUF1366 domain-containing protein | - |
| C7K40_RS02120 (C7K40_02120) | - | 378027..378299 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| C7K40_RS02125 (C7K40_02125) | - | 378296..378523 (+) | 228 | WP_003058873.1 | phage holin | - |
| C7K40_RS02130 (C7K40_02130) | - | 378639..379841 (+) | 1203 | WP_020837640.1 | glucosaminidase domain-containing protein | - |
| C7K40_RS02135 (C7K40_02135) | - | 379981..380505 (+) | 525 | WP_011017840.1 | type II toxin-antitoxin system antitoxin SocA domain-containing protein | - |
| C7K40_RS02140 (C7K40_02140) | - | 380493..381359 (+) | 867 | WP_011888701.1 | DUF334 domain-containing protein | - |
| C7K40_RS02145 (C7K40_02145) | - | 381409..381843 (-) | 435 | WP_011017966.1 | hypothetical protein | - |
| C7K40_RS02150 (C7K40_02150) | sda3 | 382115..382915 (-) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| C7K40_RS02155 (C7K40_02155) | prx | 383153..383335 (+) | 183 | WP_011184907.1 | hypothetical protein | Regulator |
| C7K40_RS02160 (C7K40_02160) | uvrA | 383562..386390 (+) | 2829 | WP_021340890.1 | excinuclease ABC subunit UvrA | - |
| C7K40_RS02165 (C7K40_02165) | - | 386506..387579 (+) | 1074 | WP_002988490.1 | Xaa-Pro peptidase family protein | - |
| C7K40_RS02170 (C7K40_02170) | - | 387614..388075 (+) | 462 | WP_002988493.1 | deaminase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6976.99 Da Isoelectric Point: 4.2550
>NTDB_id=280441 C7K40_RS02155 WP_011184907.1 383153..383335(+) (prx) [Streptococcus pyogenes strain DMG1800716]
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEIVEEVMVELDK
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEIVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=280441 C7K40_RS02155 WP_011184907.1 383153..383335(+) (prx) [Streptococcus pyogenes strain DMG1800716]
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGATAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGATAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |