Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | SPYM_RS03630 | Genome accession | NC_009332 |
| Coordinates | 690051..690233 (+) | Length | 60 a.a. |
| NCBI ID | WP_011888783.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes str. Manfredo | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 652636..690233 | 690051..690233 | within | 0 |
Gene organization within MGE regions
Location: 652636..690233
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPYM_RS03340 (SpyM50628) | - | 652654..653496 (+) | 843 | WP_011888746.1 | SGNH/GDSL hydrolase family protein | - |
| SPYM_RS03345 (SpyM50629) | - | 653474..654061 (+) | 588 | WP_002989129.1 | YpmS family protein | - |
| SPYM_RS03350 (SpyM50630) | - | 654160..654435 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| SPYM_RS03355 (SpyM50631) | - | 654525..655667 (-) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| SPYM_RS03360 (SpyM50632) | - | 655791..656057 (-) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| SPYM_RS03365 (SpyM50633) | - | 656069..656455 (-) | 387 | WP_011888747.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SPYM_RS03370 (SpyM50634) | - | 656458..656808 (-) | 351 | WP_011888748.1 | helix-turn-helix domain-containing protein | - |
| SPYM_RS03375 (SpyM50635) | - | 657116..657331 (+) | 216 | WP_011888749.1 | hypothetical protein | - |
| SPYM_RS10090 (SpyM50636) | - | 657344..657478 (+) | 135 | WP_011888750.1 | hypothetical protein | - |
| SPYM_RS03380 (SpyM50636A) | - | 657841..658026 (+) | 186 | WP_011888751.1 | helix-turn-helix domain-containing protein | - |
| SPYM_RS03385 (SpyM50638) | - | 658105..658416 (+) | 312 | WP_002990080.1 | hypothetical protein | - |
| SPYM_RS03390 (SpyM50639) | - | 658418..658603 (+) | 186 | WP_011888752.1 | hypothetical protein | - |
| SPYM_RS09965 (SpyM50640) | - | 658697..658966 (+) | 270 | WP_038433488.1 | replication protein | - |
| SPYM_RS03400 (SpyM50641) | - | 659121..659507 (+) | 387 | WP_002985388.1 | DnaD domain-containing protein | - |
| SPYM_RS03405 (SpyM50642) | - | 659488..659721 (+) | 234 | WP_002985387.1 | hypothetical protein | - |
| SPYM_RS09800 (SpyM50643) | - | 659718..659858 (+) | 141 | WP_011017992.1 | hypothetical protein | - |
| SPYM_RS03410 (SpyM50644) | - | 659867..660073 (+) | 207 | WP_011017565.1 | hypothetical protein | - |
| SPYM_RS03415 (SpyM50645) | - | 660129..660458 (+) | 330 | WP_011888754.1 | hypothetical protein | - |
| SPYM_RS03420 (SpyM50646) | bet | 660461..661237 (+) | 777 | WP_011888755.1 | phage recombination protein Bet | - |
| SPYM_RS03425 (SpyM50647) | - | 661247..662275 (+) | 1029 | WP_011888756.1 | DUF1351 domain-containing protein | - |
| SPYM_RS03430 (SpyM50649) | - | 662471..662812 (+) | 342 | WP_011888757.1 | hypothetical protein | - |
| SPYM_RS03435 (SpyM50650) | - | 662809..663321 (+) | 513 | WP_011888758.1 | hypothetical protein | - |
| SPYM_RS09970 (SpyM50651) | - | 663308..663493 (+) | 186 | WP_011017985.1 | hypothetical protein | - |
| SPYM_RS03445 (SpyM50652) | - | 663572..663763 (+) | 192 | WP_414820253.1 | hypothetical protein | - |
| SPYM_RS03450 (SpyM50653) | - | 663753..664517 (+) | 765 | WP_011888760.1 | DNA-methyltransferase | - |
| SPYM_RS03455 (SpyM50654) | - | 664643..664858 (+) | 216 | WP_032463293.1 | hypothetical protein | - |
| SPYM_RS03460 (SpyM50655) | - | 664855..665376 (+) | 522 | WP_011888762.1 | DUF1642 domain-containing protein | - |
| SPYM_RS09805 | - | 665373..665543 (+) | 171 | WP_002987493.1 | hypothetical protein | - |
| SPYM_RS03465 (SpyM50657) | - | 665810..666229 (+) | 420 | WP_011888763.1 | DUF1492 domain-containing protein | - |
| SPYM_RS03470 (SpyM50658) | - | 666338..666682 (+) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| SPYM_RS03475 (SpyM50659) | - | 666831..667187 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| SPYM_RS03480 (SpyM50660) | - | 667184..668452 (+) | 1269 | WP_011017979.1 | phage portal protein | - |
| SPYM_RS03485 (SpyM50661) | - | 668445..669938 (+) | 1494 | WP_011017978.1 | hypothetical protein | - |
| SPYM_RS03490 (SpyM50662) | - | 669944..670168 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| SPYM_RS09810 (SpyM50663) | - | 670245..670397 (+) | 153 | WP_011054687.1 | hypothetical protein | - |
| SPYM_RS03495 (SpyM50664) | - | 670390..670656 (+) | 267 | WP_002986828.1 | hypothetical protein | - |
| SPYM_RS03500 (SpyM50665) | - | 670658..670894 (+) | 237 | WP_011888764.1 | hypothetical protein | - |
| SPYM_RS03505 (SpyM50666) | - | 670976..672391 (+) | 1416 | WP_011888765.1 | terminase | - |
| SPYM_RS03510 (SpyM50667) | - | 672462..672923 (+) | 462 | WP_011888766.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| SPYM_RS03515 (SpyM50668) | - | 672948..673859 (+) | 912 | WP_011888767.1 | phage major capsid protein | - |
| SPYM_RS03520 (SpyM50669) | - | 673859..674059 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| SPYM_RS03525 (SpyM50670) | - | 674069..674491 (+) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| SPYM_RS03530 (SpyM50671) | - | 674451..674789 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| SPYM_RS03535 (SpyM50672) | - | 674782..675018 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| SPYM_RS03540 (SpyM50673) | - | 675019..675354 (+) | 336 | WP_000573598.1 | hypothetical protein | - |
| SPYM_RS03545 (SpyM50674) | - | 675366..675944 (+) | 579 | WP_011888768.1 | hypothetical protein | - |
| SPYM_RS03550 (SpyM50675) | - | 675955..676218 (+) | 264 | WP_010922455.1 | hypothetical protein | - |
| SPYM_RS03555 (SpyM50676) | - | 676233..676604 (+) | 372 | WP_011528785.1 | DUF5361 domain-containing protein | - |
| SPYM_RS03560 (SpyM50677) | - | 676604..678961 (+) | 2358 | WP_011888769.1 | phage tail protein | - |
| SPYM_RS03565 (SpyM50678) | - | 678958..679653 (+) | 696 | WP_011888770.1 | hypothetical protein | - |
| SPYM_RS03570 (SpyM50679) | - | 679635..681611 (+) | 1977 | WP_041174190.1 | phage tail spike protein | - |
| SPYM_RS03575 (SpyM50680) | hylP | 681608..682624 (+) | 1017 | WP_011888772.1 | hyaluronidase HylP | - |
| SPYM_RS03580 (SpyM50681) | - | 682639..684423 (+) | 1785 | WP_011888773.1 | gp58-like family protein | - |
| SPYM_RS03585 (SpyM50682) | - | 684435..684863 (+) | 429 | WP_011888774.1 | DUF1617 family protein | - |
| SPYM_RS03590 (SpyM50683) | - | 684866..685498 (+) | 633 | WP_011888775.1 | hypothetical protein | - |
| SPYM_RS03595 (SpyM50684) | - | 685509..685808 (+) | 300 | WP_002988799.1 | hypothetical protein | - |
| SPYM_RS03600 (SpyM50685) | - | 685805..685990 (+) | 186 | WP_011888776.1 | holin | - |
| SPYM_RS03610 (SpyM50687) | - | 686104..687327 (+) | 1224 | WP_011888778.1 | peptidoglycan amidohydrolase family protein | - |
| SPYM_RS03615 (SpyM50689) | - | 687614..688585 (+) | 972 | WP_011888780.1 | Abi family protein | - |
| SPYM_RS03620 (SpyM50690) | - | 688769..688969 (+) | 201 | WP_011888781.1 | CsbD family protein | - |
| SPYM_RS03625 (SpyM50691) | - | 689191..689985 (+) | 795 | WP_011888782.1 | DNA/RNA non-specific endonuclease | - |
| SPYM_RS03630 (SpyM50692) | prx | 690051..690233 (+) | 183 | WP_011888783.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6917.86 Da Isoelectric Point: 4.3455
>NTDB_id=27859 SPYM_RS03630 WP_011888783.1 690051..690233(+) (prx) [Streptococcus pyogenes str. Manfredo]
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=27859 SPYM_RS03630 WP_011888783.1 690051..690233(+) (prx) [Streptococcus pyogenes str. Manfredo]
ATGTTAACATACGATGAATTTAAGCAAGCGATTGACAATGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGTTAACATACGATGAATTTAAGCAAGCGATTGACAATGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
93.333 |
100 |
0.933 |
| prx | Streptococcus pyogenes MGAS315 |
91.667 |
100 |
0.917 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |