Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | SPYM_RS02895 | Genome accession | NC_009332 |
| Coordinates | 554146..554328 (+) | Length | 60 a.a. |
| NCBI ID | WP_011184907.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes str. Manfredo | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 513249..554328 | 554146..554328 | within | 0 |
Gene organization within MGE regions
Location: 513249..554328
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPYM_RS02620 (SpyM50471) | - | 513249..514334 (-) | 1086 | WP_011888676.1 | tyrosine-type recombinase/integrase | - |
| SPYM_RS02625 (SpyM50472) | - | 514516..515937 (-) | 1422 | WP_011888677.1 | DUF4041 domain-containing protein | - |
| SPYM_RS02630 (SpyM50473) | - | 515952..516338 (-) | 387 | WP_041174188.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SPYM_RS02635 (SpyM50474) | - | 516322..516663 (-) | 342 | WP_011888679.1 | helix-turn-helix domain-containing protein | - |
| SPYM_RS02640 (SpyM50475) | - | 516861..517073 (+) | 213 | WP_014635614.1 | DNA-binding protein | - |
| SPYM_RS02645 (SpyM50476) | - | 517101..517820 (+) | 720 | WP_011888681.1 | phage antirepressor KilAC domain-containing protein | - |
| SPYM_RS02650 (SpyM50477) | - | 517918..518157 (-) | 240 | WP_011284879.1 | hypothetical protein | - |
| SPYM_RS02655 (SpyM50478) | - | 518324..518509 (+) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| SPYM_RS02660 (SpyM50479) | - | 518580..518831 (+) | 252 | WP_011888682.1 | helix-turn-helix transcriptional regulator | - |
| SPYM_RS09780 (SpyM50480) | - | 518862..518999 (+) | 138 | WP_011017881.1 | hypothetical protein | - |
| SPYM_RS02665 (SpyM50481) | - | 519093..519809 (+) | 717 | WP_011888683.1 | DnaD domain protein | - |
| SPYM_RS02670 (SpyM50482) | - | 519796..520578 (+) | 783 | WP_011888684.1 | ATP-binding protein | - |
| SPYM_RS02675 (SpyM50484) | - | 520719..521072 (+) | 354 | WP_011285579.1 | hypothetical protein | - |
| SPYM_RS02680 (SpyM50485) | - | 521053..521307 (+) | 255 | WP_011018143.1 | hypothetical protein | - |
| SPYM_RS02685 (SpyM50486) | - | 521329..521811 (+) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| SPYM_RS10145 | - | 521812..522477 (+) | 666 | Protein_473 | ERF family protein | - |
| SPYM_RS09920 | ssb | 522478..522903 (+) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| SPYM_RS02700 (SpyM50488) | - | 522909..523112 (+) | 204 | WP_011106686.1 | hypothetical protein | - |
| SPYM_RS02705 (SpyM50489) | - | 523112..523552 (+) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| SPYM_RS02710 (SpyM50490) | - | 523549..523905 (+) | 357 | WP_011284873.1 | hypothetical protein | - |
| SPYM_RS10115 (SpyM50491) | - | 523902..524147 (+) | 246 | WP_011285573.1 | hypothetical protein | - |
| SPYM_RS02720 (SpyM50492) | - | 524147..524383 (+) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| SPYM_RS09790 (SpyM50493) | - | 524380..524550 (+) | 171 | WP_002995952.1 | hypothetical protein | - |
| SPYM_RS02725 (SpyM50494) | - | 524547..524831 (+) | 285 | WP_011284869.1 | hypothetical protein | - |
| SPYM_RS02730 (SpyM50495) | - | 524833..525465 (+) | 633 | WP_011888685.1 | N-6 DNA methylase | - |
| SPYM_RS02735 (SpyM50496) | - | 525470..525949 (+) | 480 | WP_011888686.1 | DUF1642 domain-containing protein | - |
| SPYM_RS09795 (SpyM50497) | - | 525946..526116 (+) | 171 | WP_002987493.1 | hypothetical protein | - |
| SPYM_RS02740 (SpyM50499) | - | 526400..526834 (+) | 435 | WP_011888687.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| SPYM_RS02745 (SpyM50501) | - | 527468..528634 (+) | 1167 | Protein_486 | DNA modification methylase | - |
| SPYM_RS02750 (SpyM50504) | - | 528978..529454 (+) | 477 | WP_010922073.1 | hypothetical protein | - |
| SPYM_RS02755 (SpyM50505) | - | 529537..530748 (+) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| SPYM_RS02760 (SpyM50506) | - | 530762..532264 (+) | 1503 | WP_010922075.1 | phage portal protein | - |
| SPYM_RS02765 (SpyM50507) | - | 532269..533762 (+) | 1494 | Protein_490 | phage minor capsid protein | - |
| SPYM_RS02770 (SpyM50509) | - | 533762..533989 (+) | 228 | WP_010922077.1 | hypothetical protein | - |
| SPYM_RS02775 (SpyM50510) | - | 534076..534342 (+) | 267 | WP_011888689.1 | hypothetical protein | - |
| SPYM_RS02780 (SpyM50511) | - | 534468..535082 (+) | 615 | WP_011888690.1 | hypothetical protein | - |
| SPYM_RS02785 (SpyM50512) | - | 535086..535904 (+) | 819 | WP_011888691.1 | N4-gp56 family major capsid protein | - |
| SPYM_RS02790 (SpyM50513) | - | 535958..536374 (+) | 417 | WP_011888692.1 | hypothetical protein | - |
| SPYM_RS02795 (SpyM50514) | - | 536364..536696 (+) | 333 | WP_011888693.1 | minor capsid protein | - |
| SPYM_RS02800 (SpyM50515) | - | 536696..537052 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| SPYM_RS02805 (SpyM50516) | - | 537049..537447 (+) | 399 | WP_011888694.1 | minor capsid protein | - |
| SPYM_RS02810 (SpyM50517) | - | 537447..537908 (+) | 462 | WP_011018120.1 | phage tail tube protein | - |
| SPYM_RS02815 (SpyM50518) | - | 537952..538386 (+) | 435 | WP_011888695.1 | hypothetical protein | - |
| SPYM_RS02820 (SpyM50519) | - | 538390..538971 (+) | 582 | WP_011888696.1 | bacteriophage Gp15 family protein | - |
| SPYM_RS02825 (SpyM50521) | - | 538961..542215 (+) | 3255 | Protein_502 | tape measure protein | - |
| SPYM_RS02830 (SpyM50522) | - | 542212..542928 (+) | 717 | WP_011888697.1 | distal tail protein Dit | - |
| SPYM_RS02835 (SpyM50523) | - | 542925..545069 (+) | 2145 | WP_011888698.1 | phage tail spike protein | - |
| SPYM_RS02840 (SpyM50524) | - | 545066..546076 (+) | 1011 | WP_011017589.1 | hyaluronoglucosaminidase | - |
| SPYM_RS02845 (SpyM50525) | - | 546089..547974 (+) | 1886 | Protein_506 | gp58-like family protein | - |
| SPYM_RS02850 (SpyM50527) | - | 547986..548417 (+) | 432 | WP_002983467.1 | DUF1617 family protein | - |
| SPYM_RS02855 (SpyM50528) | - | 548420..549052 (+) | 633 | WP_011888699.1 | hypothetical protein | - |
| SPYM_RS02860 (SpyM50529) | - | 549062..549517 (+) | 456 | WP_011184730.1 | phage holin family protein | - |
| SPYM_RS10080 | - | 549519..549641 (+) | 123 | WP_029713948.1 | hypothetical protein | - |
| SPYM_RS02870 (SpyM50530) | - | 549629..550834 (+) | 1206 | WP_011888700.1 | glucosaminidase domain-containing protein | - |
| SPYM_RS02875 (SpyM50531) | - | 550974..551498 (+) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| SPYM_RS02880 (SpyM50532) | - | 551486..552352 (+) | 867 | WP_011888701.1 | DUF334 domain-containing protein | - |
| SPYM_RS02885 (SpyM50533) | - | 552402..552836 (-) | 435 | WP_011888702.1 | hypothetical protein | - |
| SPYM_RS02890 (SpyM50534) | sda3 | 553108..553908 (-) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| SPYM_RS02895 (SpyM50535) | prx | 554146..554328 (+) | 183 | WP_011184907.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6976.99 Da Isoelectric Point: 4.2550
>NTDB_id=27856 SPYM_RS02895 WP_011184907.1 554146..554328(+) (prx) [Streptococcus pyogenes str. Manfredo]
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEIVEEVMVELDK
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEIVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=27856 SPYM_RS02895 WP_011184907.1 554146..554328(+) (prx) [Streptococcus pyogenes str. Manfredo]
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGATAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGATAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |