Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | C1191_RS10400 | Genome accession | NZ_CP026097 |
| Coordinates | 1976191..1976628 (-) | Length | 145 a.a. |
| NCBI ID | WP_101512092.1 | Uniprot ID | - |
| Organism | Lacticaseibacillus paracasei strain HDS-01 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1939895..1983588 | 1976191..1976628 | within | 0 |
Gene organization within MGE regions
Location: 1939895..1983588
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C1191_RS10150 | - | 1939895..1940386 (-) | 492 | WP_003579810.1 | FeoA family protein | - |
| C1191_RS10155 | - | 1940585..1941337 (-) | 753 | WP_003579812.1 | acyltransferase | - |
| C1191_RS10160 | - | 1941820..1943109 (-) | 1290 | WP_101512056.1 | LysM peptidoglycan-binding domain-containing protein | - |
| C1191_RS10165 | - | 1943120..1943533 (-) | 414 | WP_071252206.1 | phage holin | - |
| C1191_RS10170 | - | 1943548..1943898 (-) | 351 | WP_225365899.1 | hypothetical protein | - |
| C1191_RS10175 | - | 1943879..1944010 (-) | 132 | WP_032779081.1 | XkdX family protein | - |
| C1191_RS10180 | - | 1944007..1944279 (-) | 273 | WP_101512006.1 | hypothetical protein | - |
| C1191_RS16125 | - | 1944291..1947734 (-) | 3444 | WP_225366400.1 | phage tail spike protein | - |
| C1191_RS10195 | - | 1947734..1949668 (-) | 1935 | WP_101512057.1 | distal tail protein Dit | - |
| C1191_RS10200 | - | 1949669..1954531 (-) | 4863 | WP_101512058.1 | phage tail tape measure protein | - |
| C1191_RS10205 | gpG | 1954654..1955067 (-) | 414 | WP_101512059.1 | phage tail assembly chaperone G | - |
| C1191_RS10210 | - | 1955166..1955783 (-) | 618 | WP_101512060.1 | major tail protein | - |
| C1191_RS10215 | - | 1955817..1956203 (-) | 387 | WP_101512061.1 | phage tail protein | - |
| C1191_RS10220 | - | 1956203..1956589 (-) | 387 | WP_101512062.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| C1191_RS10225 | - | 1956589..1956918 (-) | 330 | WP_101512063.1 | head-tail adaptor protein | - |
| C1191_RS10230 | - | 1956908..1957267 (-) | 360 | WP_101512064.1 | head-tail connector protein | - |
| C1191_RS10235 | - | 1957278..1957517 (-) | 240 | WP_101512065.1 | Ig-like domain-containing protein | - |
| C1191_RS10240 | - | 1957535..1958737 (-) | 1203 | WP_101512066.1 | phage major capsid protein | - |
| C1191_RS10245 | - | 1958778..1959407 (-) | 630 | WP_101512067.1 | HK97 family phage prohead protease | - |
| C1191_RS10250 | - | 1959361..1960614 (-) | 1254 | WP_101512068.1 | phage portal protein | - |
| C1191_RS10255 | - | 1960620..1960811 (-) | 192 | WP_003661399.1 | hypothetical protein | - |
| C1191_RS10260 | - | 1960823..1962535 (-) | 1713 | WP_101512069.1 | terminase large subunit | - |
| C1191_RS10265 | - | 1962557..1963012 (-) | 456 | WP_003661401.1 | P27 family phage terminase small subunit | - |
| C1191_RS10270 | - | 1963211..1964005 (-) | 795 | WP_101512070.1 | HNH endonuclease | - |
| C1191_RS10275 | - | 1963995..1964576 (-) | 582 | WP_101512071.1 | hypothetical protein | - |
| C1191_RS10280 | - | 1964589..1964912 (-) | 324 | WP_101512072.1 | hypothetical protein | - |
| C1191_RS10285 | - | 1964915..1965244 (-) | 330 | WP_101512073.1 | ribonucleoside-diphosphate reductase | - |
| C1191_RS10290 | - | 1965231..1966448 (-) | 1218 | WP_101512074.1 | GcrA family cell cycle regulator | - |
| C1191_RS10295 | - | 1966819..1967250 (-) | 432 | WP_101512075.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| C1191_RS10300 | - | 1967319..1967537 (-) | 219 | WP_101512076.1 | helix-turn-helix domain-containing protein | - |
| C1191_RS10310 | - | 1967608..1967790 (-) | 183 | WP_101512077.1 | hypothetical protein | - |
| C1191_RS10315 | - | 1967774..1968010 (-) | 237 | WP_101512078.1 | hypothetical protein | - |
| C1191_RS10320 | - | 1967997..1968437 (-) | 441 | WP_101512079.1 | YopX family protein | - |
| C1191_RS10325 | - | 1968434..1968631 (-) | 198 | WP_225366401.1 | hypothetical protein | - |
| C1191_RS10330 | - | 1968628..1969008 (-) | 381 | WP_101512080.1 | hypothetical protein | - |
| C1191_RS15995 | - | 1969317..1969493 (-) | 177 | WP_189260170.1 | hypothetical protein | - |
| C1191_RS10340 | - | 1969483..1970034 (-) | 552 | WP_101512082.1 | hypothetical protein | - |
| C1191_RS10345 | - | 1969997..1970140 (-) | 144 | WP_101512083.1 | acetyltransferase | - |
| C1191_RS10350 | - | 1970153..1970761 (-) | 609 | WP_101512084.1 | hypothetical protein | - |
| C1191_RS10355 | - | 1970772..1971695 (-) | 924 | WP_103153497.1 | site-specific integrase | - |
| C1191_RS10360 | - | 1971682..1972392 (-) | 711 | WP_101512085.1 | N-6 DNA methylase | - |
| C1191_RS10365 | - | 1972389..1972631 (-) | 243 | WP_101512086.1 | hypothetical protein | - |
| C1191_RS10375 | - | 1972891..1973274 (-) | 384 | WP_101512088.1 | DUF1064 domain-containing protein | - |
| C1191_RS10380 | - | 1973277..1973726 (-) | 450 | WP_101512089.1 | hypothetical protein | - |
| C1191_RS10385 | - | 1973739..1974083 (-) | 345 | WP_003579409.1 | hypothetical protein | - |
| C1191_RS10390 | - | 1974085..1975347 (-) | 1263 | WP_101512090.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| C1191_RS10395 | - | 1975344..1976174 (-) | 831 | WP_101512091.1 | helix-turn-helix domain-containing protein | - |
| C1191_RS10400 | ssb | 1976191..1976628 (-) | 438 | WP_101512092.1 | single-stranded DNA-binding protein | Machinery gene |
| C1191_RS10405 | - | 1976643..1977311 (-) | 669 | WP_101512338.1 | putative HNHc nuclease | - |
| C1191_RS10410 | - | 1977314..1978069 (-) | 756 | WP_101512093.1 | ERF family protein | - |
| C1191_RS10415 | - | 1978080..1978571 (-) | 492 | WP_101512094.1 | siphovirus Gp157 family protein | - |
| C1191_RS10420 | - | 1978589..1978792 (-) | 204 | WP_101512095.1 | hypothetical protein | - |
| C1191_RS10430 | - | 1979030..1979353 (-) | 324 | WP_101512097.1 | DUF771 domain-containing protein | - |
| C1191_RS10435 | - | 1979404..1979661 (-) | 258 | WP_101512098.1 | helix-turn-helix domain-containing protein | - |
| C1191_RS10440 | - | 1979662..1980429 (-) | 768 | WP_101512099.1 | phage antirepressor KilAC domain-containing protein | - |
| C1191_RS10445 | - | 1980426..1980671 (-) | 246 | WP_015992507.1 | helix-turn-helix transcriptional regulator | - |
| C1191_RS10450 | - | 1980833..1981507 (+) | 675 | WP_103153498.1 | LexA family transcriptional regulator | - |
| C1191_RS10455 | - | 1981567..1982244 (+) | 678 | WP_101512101.1 | transcriptional regulator | - |
| C1191_RS10460 | - | 1982419..1983588 (+) | 1170 | WP_101512102.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 145 a.a. Molecular weight: 15913.43 Da Isoelectric Point: 4.8781
>NTDB_id=267115 C1191_RS10400 WP_101512092.1 1976191..1976628(-) (ssb) [Lacticaseibacillus paracasei strain HDS-01]
MLNSVALTGRLTKDVDLRYTQSGTAVGSFTIAVDRQFRSANGERETDFINCAIWRKSAENFANFTHKGSLVGIEGHIQTR
TYDNAQGQRVFVTEVIVENFALLEPRQTSQEGQQRSANNPAATSQGNGFANNGQPVDVSDDDLPF
MLNSVALTGRLTKDVDLRYTQSGTAVGSFTIAVDRQFRSANGERETDFINCAIWRKSAENFANFTHKGSLVGIEGHIQTR
TYDNAQGQRVFVTEVIVENFALLEPRQTSQEGQQRSANNPAATSQGNGFANNGQPVDVSDDDLPF
Nucleotide
Download Length: 438 bp
>NTDB_id=267115 C1191_RS10400 WP_101512092.1 1976191..1976628(-) (ssb) [Lacticaseibacillus paracasei strain HDS-01]
ATGCTTAATTCAGTTGCTTTAACAGGCAGATTAACTAAAGACGTTGACCTTCGCTACACACAAAGCGGAACGGCAGTTGG
CTCATTTACGATTGCTGTTGATCGCCAATTTCGTAGCGCAAATGGGGAACGTGAAACTGACTTCATCAATTGTGCTATCT
GGCGTAAGTCTGCTGAGAACTTTGCCAACTTCACGCACAAGGGTTCACTTGTTGGCATCGAAGGTCATATCCAAACACGT
ACGTACGATAACGCGCAAGGCCAGAGGGTATTCGTGACTGAGGTGATTGTTGAAAATTTCGCCTTGCTTGAGCCACGGCA
GACGTCTCAGGAAGGCCAACAACGATCGGCTAATAACCCAGCGGCTACAAGCCAAGGAAACGGTTTTGCCAACAATGGCC
AGCCAGTCGATGTCAGCGATGATGATCTTCCATTCTAG
ATGCTTAATTCAGTTGCTTTAACAGGCAGATTAACTAAAGACGTTGACCTTCGCTACACACAAAGCGGAACGGCAGTTGG
CTCATTTACGATTGCTGTTGATCGCCAATTTCGTAGCGCAAATGGGGAACGTGAAACTGACTTCATCAATTGTGCTATCT
GGCGTAAGTCTGCTGAGAACTTTGCCAACTTCACGCACAAGGGTTCACTTGTTGGCATCGAAGGTCATATCCAAACACGT
ACGTACGATAACGCGCAAGGCCAGAGGGTATTCGTGACTGAGGTGATTGTTGAAAATTTCGCCTTGCTTGAGCCACGGCA
GACGTCTCAGGAAGGCCAACAACGATCGGCTAATAACCCAGCGGCTACAAGCCAAGGAAACGGTTTTGCCAACAATGGCC
AGCCAGTCGATGTCAGCGATGATGATCTTCCATTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
58.235 |
100 |
0.683 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
49.419 |
100 |
0.586 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
53.774 |
73.103 |
0.393 |
| ssb | Neisseria gonorrhoeae MS11 |
32.558 |
100 |
0.386 |
| ssb | Neisseria meningitidis MC58 |
31.977 |
100 |
0.379 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
37.931 |
100 |
0.379 |
| ssb | Vibrio cholerae strain A1552 |
30.114 |
100 |
0.366 |