Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | C2E56_RS03335 | Genome accession | NZ_CP026084 |
| Coordinates | 599036..599224 (+) | Length | 62 a.a. |
| NCBI ID | WP_000027835.1 | Uniprot ID | A0AAV3JNT7 |
| Organism | Streptococcus agalactiae strain NJ1606 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| IS/Tn | 597969..598580 | 599036..599224 | flank | 456 |
| Genomic island | 590251..598994 | 599036..599224 | flank | 42 |
Gene organization within MGE regions
Location: 590251..599224
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C2E56_RS03295 (C2E56_03390) | - | 591630..591791 (-) | 162 | WP_000508795.1 | TM2 domain-containing protein | - |
| C2E56_RS03300 (C2E56_03395) | - | 592533..593810 (+) | 1278 | WP_000594360.1 | ABC transporter permease | - |
| C2E56_RS03305 (C2E56_03400) | - | 593820..594476 (+) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| C2E56_RS03310 (C2E56_03405) | - | 594476..595851 (+) | 1376 | Protein_570 | ABC transporter permease | - |
| C2E56_RS03315 (C2E56_03410) | - | 595948..596601 (+) | 654 | WP_000699093.1 | response regulator transcription factor | - |
| C2E56_RS03320 (C2E56_03415) | - | 596598..597917 (+) | 1320 | WP_000734169.1 | sensor histidine kinase | - |
| C2E56_RS03325 (C2E56_03420) | - | 597969..598616 (-) | 648 | Protein_573 | IS3 family transposase | - |
| C2E56_RS03330 (C2E56_03425) | - | 598794..598994 (+) | 201 | WP_000076708.1 | CsbD family protein | - |
| C2E56_RS03335 (C2E56_03430) | prx | 599036..599224 (+) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7180.25 Da Isoelectric Point: 4.7815
>NTDB_id=266944 C2E56_RS03335 WP_000027835.1 599036..599224(+) (prx) [Streptococcus agalactiae strain NJ1606]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
Nucleotide
Download Length: 189 bp
>NTDB_id=266944 C2E56_RS03335 WP_000027835.1 599036..599224(+) (prx) [Streptococcus agalactiae strain NJ1606]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.222 |
87.097 |
0.629 |
| prx | Streptococcus pyogenes MGAS8232 |
69.091 |
88.71 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
87.097 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
64.516 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
61.818 |
88.71 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
74.359 |
62.903 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
78.378 |
59.677 |
0.468 |