Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | CWS34_RS10410 | Genome accession | NZ_CP025582 |
| Coordinates | 1976500..1976937 (-) | Length | 145 a.a. |
| NCBI ID | WP_101512092.1 | Uniprot ID | - |
| Organism | Lacticaseibacillus paracasei strain HD1.7 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1942130..1983898 | 1976500..1976937 | within | 0 |
Gene organization within MGE regions
Location: 1942130..1983898
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CWS34_RS10170 | - | 1942130..1943419 (-) | 1290 | WP_101512056.1 | LysM peptidoglycan-binding domain-containing protein | - |
| CWS34_RS10175 | - | 1943430..1943843 (-) | 414 | WP_071252206.1 | phage holin | - |
| CWS34_RS10180 | - | 1943858..1944208 (-) | 351 | WP_225365899.1 | hypothetical protein | - |
| CWS34_RS10185 | - | 1944189..1944320 (-) | 132 | WP_032779081.1 | XkdX family protein | - |
| CWS34_RS10190 | - | 1944317..1944589 (-) | 273 | WP_101512006.1 | hypothetical protein | - |
| CWS34_RS16140 | - | 1944601..1948044 (-) | 3444 | WP_225366400.1 | phage tail spike protein | - |
| CWS34_RS10205 | - | 1948044..1949978 (-) | 1935 | WP_101512057.1 | distal tail protein Dit | - |
| CWS34_RS10210 | - | 1949979..1954841 (-) | 4863 | WP_101512058.1 | phage tail tape measure protein | - |
| CWS34_RS10215 | gpG | 1954964..1955377 (-) | 414 | WP_101512059.1 | phage tail assembly chaperone G | - |
| CWS34_RS10220 | - | 1955476..1956093 (-) | 618 | WP_101512060.1 | major tail protein | - |
| CWS34_RS10225 | - | 1956127..1956513 (-) | 387 | WP_101512061.1 | phage tail protein | - |
| CWS34_RS10230 | - | 1956513..1956899 (-) | 387 | WP_101512062.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| CWS34_RS10235 | - | 1956899..1957228 (-) | 330 | WP_101512063.1 | head-tail adaptor protein | - |
| CWS34_RS10240 | - | 1957218..1957577 (-) | 360 | WP_101512064.1 | head-tail connector protein | - |
| CWS34_RS10245 | - | 1957588..1957827 (-) | 240 | WP_101512065.1 | Ig-like domain-containing protein | - |
| CWS34_RS10250 | - | 1957845..1959047 (-) | 1203 | WP_101512066.1 | phage major capsid protein | - |
| CWS34_RS10255 | - | 1959088..1959717 (-) | 630 | WP_101512067.1 | HK97 family phage prohead protease | - |
| CWS34_RS10260 | - | 1959671..1960924 (-) | 1254 | WP_101512068.1 | phage portal protein | - |
| CWS34_RS10265 | - | 1960930..1961121 (-) | 192 | WP_003661399.1 | hypothetical protein | - |
| CWS34_RS10270 | - | 1961133..1962845 (-) | 1713 | WP_101512069.1 | terminase large subunit | - |
| CWS34_RS10275 | - | 1962867..1963322 (-) | 456 | WP_003661401.1 | P27 family phage terminase small subunit | - |
| CWS34_RS10280 | - | 1963521..1964315 (-) | 795 | WP_101512070.1 | HNH endonuclease | - |
| CWS34_RS10285 | - | 1964305..1964886 (-) | 582 | WP_101512071.1 | hypothetical protein | - |
| CWS34_RS10290 | - | 1964899..1965222 (-) | 324 | WP_101512072.1 | hypothetical protein | - |
| CWS34_RS10295 | - | 1965225..1965554 (-) | 330 | WP_101512073.1 | ribonucleoside-diphosphate reductase | - |
| CWS34_RS10300 | - | 1965541..1966758 (-) | 1218 | WP_101512074.1 | GcrA family cell cycle regulator | - |
| CWS34_RS10305 | - | 1967129..1967560 (-) | 432 | WP_101512075.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| CWS34_RS10310 | - | 1967629..1967847 (-) | 219 | WP_101512076.1 | helix-turn-helix domain-containing protein | - |
| CWS34_RS10320 | - | 1967918..1968100 (-) | 183 | WP_101512077.1 | hypothetical protein | - |
| CWS34_RS10325 | - | 1968084..1968320 (-) | 237 | WP_101512078.1 | hypothetical protein | - |
| CWS34_RS10330 | - | 1968307..1968747 (-) | 441 | WP_101512079.1 | YopX family protein | - |
| CWS34_RS10335 | - | 1968744..1968941 (-) | 198 | WP_225366401.1 | hypothetical protein | - |
| CWS34_RS10340 | - | 1968938..1969318 (-) | 381 | WP_101512080.1 | hypothetical protein | - |
| CWS34_RS15995 | - | 1969627..1969803 (-) | 177 | WP_189260170.1 | hypothetical protein | - |
| CWS34_RS10350 | - | 1969793..1970344 (-) | 552 | WP_101512082.1 | hypothetical protein | - |
| CWS34_RS10355 | - | 1970307..1970450 (-) | 144 | WP_101512083.1 | acetyltransferase | - |
| CWS34_RS10360 | - | 1970463..1971071 (-) | 609 | WP_101512084.1 | hypothetical protein | - |
| CWS34_RS10365 | - | 1971082..1972004 (-) | 923 | Protein_1883 | site-specific integrase | - |
| CWS34_RS10370 | - | 1971991..1972701 (-) | 711 | WP_101512085.1 | N-6 DNA methylase | - |
| CWS34_RS10375 | - | 1972698..1972940 (-) | 243 | WP_101512086.1 | hypothetical protein | - |
| CWS34_RS10385 | - | 1973200..1973583 (-) | 384 | WP_101512088.1 | DUF1064 domain-containing protein | - |
| CWS34_RS10390 | - | 1973586..1974035 (-) | 450 | WP_101512089.1 | hypothetical protein | - |
| CWS34_RS10395 | - | 1974048..1974392 (-) | 345 | WP_003579409.1 | hypothetical protein | - |
| CWS34_RS10400 | - | 1974394..1975656 (-) | 1263 | WP_101512090.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| CWS34_RS10405 | - | 1975653..1976483 (-) | 831 | WP_101512091.1 | helix-turn-helix domain-containing protein | - |
| CWS34_RS10410 | ssb | 1976500..1976937 (-) | 438 | WP_101512092.1 | single-stranded DNA-binding protein | Machinery gene |
| CWS34_RS10415 | - | 1976952..1977620 (-) | 669 | WP_101512338.1 | putative HNHc nuclease | - |
| CWS34_RS10420 | - | 1977623..1978378 (-) | 756 | WP_101512093.1 | ERF family protein | - |
| CWS34_RS10425 | - | 1978389..1978880 (-) | 492 | WP_101512094.1 | siphovirus Gp157 family protein | - |
| CWS34_RS10430 | - | 1978898..1979101 (-) | 204 | WP_101512095.1 | hypothetical protein | - |
| CWS34_RS16000 | - | 1979106..1979258 (-) | 153 | WP_189284857.1 | hypothetical protein | - |
| CWS34_RS10440 | - | 1979340..1979663 (-) | 324 | WP_101512097.1 | DUF771 domain-containing protein | - |
| CWS34_RS10445 | - | 1979714..1979971 (-) | 258 | WP_101512098.1 | helix-turn-helix domain-containing protein | - |
| CWS34_RS10450 | - | 1979972..1980739 (-) | 768 | WP_101512099.1 | phage antirepressor KilAC domain-containing protein | - |
| CWS34_RS10455 | - | 1980736..1980981 (-) | 246 | WP_015992507.1 | helix-turn-helix transcriptional regulator | - |
| CWS34_RS10460 | - | 1981143..1981817 (+) | 675 | WP_101512100.1 | LexA family transcriptional regulator | - |
| CWS34_RS10465 | - | 1981877..1982554 (+) | 678 | WP_101512101.1 | transcriptional regulator | - |
| CWS34_RS10470 | - | 1982729..1983898 (+) | 1170 | WP_101512102.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 145 a.a. Molecular weight: 15913.43 Da Isoelectric Point: 4.8781
>NTDB_id=262833 CWS34_RS10410 WP_101512092.1 1976500..1976937(-) (ssb) [Lacticaseibacillus paracasei strain HD1.7]
MLNSVALTGRLTKDVDLRYTQSGTAVGSFTIAVDRQFRSANGERETDFINCAIWRKSAENFANFTHKGSLVGIEGHIQTR
TYDNAQGQRVFVTEVIVENFALLEPRQTSQEGQQRSANNPAATSQGNGFANNGQPVDVSDDDLPF
MLNSVALTGRLTKDVDLRYTQSGTAVGSFTIAVDRQFRSANGERETDFINCAIWRKSAENFANFTHKGSLVGIEGHIQTR
TYDNAQGQRVFVTEVIVENFALLEPRQTSQEGQQRSANNPAATSQGNGFANNGQPVDVSDDDLPF
Nucleotide
Download Length: 438 bp
>NTDB_id=262833 CWS34_RS10410 WP_101512092.1 1976500..1976937(-) (ssb) [Lacticaseibacillus paracasei strain HD1.7]
ATGCTTAATTCAGTTGCTTTAACAGGCAGATTAACTAAAGACGTTGACCTTCGCTACACACAAAGCGGAACGGCAGTTGG
CTCATTTACGATTGCTGTTGATCGCCAATTTCGTAGCGCAAATGGGGAACGTGAAACTGACTTCATCAATTGTGCTATCT
GGCGTAAGTCTGCTGAGAACTTTGCCAACTTCACGCACAAGGGTTCACTTGTTGGCATCGAAGGTCATATCCAAACACGT
ACGTACGATAACGCGCAAGGCCAGAGGGTATTCGTGACTGAGGTGATTGTTGAAAATTTCGCCTTGCTTGAGCCACGGCA
GACGTCTCAGGAAGGCCAACAACGATCGGCTAATAACCCAGCGGCTACAAGCCAAGGAAACGGTTTTGCCAACAATGGCC
AGCCAGTCGATGTCAGCGATGATGATCTTCCATTCTAG
ATGCTTAATTCAGTTGCTTTAACAGGCAGATTAACTAAAGACGTTGACCTTCGCTACACACAAAGCGGAACGGCAGTTGG
CTCATTTACGATTGCTGTTGATCGCCAATTTCGTAGCGCAAATGGGGAACGTGAAACTGACTTCATCAATTGTGCTATCT
GGCGTAAGTCTGCTGAGAACTTTGCCAACTTCACGCACAAGGGTTCACTTGTTGGCATCGAAGGTCATATCCAAACACGT
ACGTACGATAACGCGCAAGGCCAGAGGGTATTCGTGACTGAGGTGATTGTTGAAAATTTCGCCTTGCTTGAGCCACGGCA
GACGTCTCAGGAAGGCCAACAACGATCGGCTAATAACCCAGCGGCTACAAGCCAAGGAAACGGTTTTGCCAACAATGGCC
AGCCAGTCGATGTCAGCGATGATGATCTTCCATTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
58.235 |
100 |
0.683 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
49.419 |
100 |
0.586 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
53.774 |
73.103 |
0.393 |
| ssb | Neisseria gonorrhoeae MS11 |
32.558 |
100 |
0.386 |
| ssb | Neisseria meningitidis MC58 |
31.977 |
100 |
0.379 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
37.931 |
100 |
0.379 |
| ssb | Vibrio cholerae strain A1552 |
30.114 |
100 |
0.366 |