Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | CW339_RS09825 | Genome accession | NZ_CP025216 |
| Coordinates | 739964..740125 (-) | Length | 53 a.a. |
| NCBI ID | WP_014727422.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain DGCC 7710 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 719197..747821 | 739964..740125 | within | 0 |
Gene organization within MGE regions
Location: 719197..747821
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CW339_RS03860 (CW339_03860) | - | 719197..719793 (+) | 597 | WP_011225787.1 | thymidine kinase | - |
| CW339_RS03865 (CW339_03865) | prfA | 719830..720909 (+) | 1080 | WP_002948472.1 | peptide chain release factor 1 | - |
| CW339_RS03870 (CW339_03870) | prmC | 720906..721739 (+) | 834 | WP_011681016.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| CW339_RS03875 (CW339_03875) | - | 721726..722331 (+) | 606 | WP_002948474.1 | L-threonylcarbamoyladenylate synthase | - |
| CW339_RS03880 (CW339_03880) | glyA | 722426..723676 (+) | 1251 | WP_011227085.1 | serine hydroxymethyltransferase | - |
| CW339_RS03885 (CW339_03885) | - | 723683..724660 (+) | 978 | WP_014608183.1 | nucleoid-associated protein | - |
| CW339_RS03890 (CW339_03890) | - | 724662..725273 (+) | 612 | WP_014621429.1 | lysozyme family protein | - |
| CW339_RS03895 (CW339_03895) | - | 725306..727045 (+) | 1740 | WP_011681019.1 | ABC transporter ATP-binding protein | - |
| CW339_RS03900 (CW339_03900) | - | 727035..728783 (+) | 1749 | WP_011681020.1 | ABC transporter ATP-binding protein | - |
| CW339_RS03905 (CW339_03905) | - | 728960..729091 (+) | 132 | WP_002885174.1 | teichoic acid D-Ala incorporation-associated protein DltX | - |
| CW339_RS03910 (CW339_03910) | dltA | 729100..730650 (+) | 1551 | WP_011681022.1 | D-alanine--poly(phosphoribitol) ligase subunit DltA | - |
| CW339_RS03915 (CW339_03915) | dltB | 730647..731894 (+) | 1248 | WP_014608186.1 | D-alanyl-lipoteichoic acid biosynthesis protein DltB | - |
| CW339_RS03920 (CW339_03920) | dltC | 731912..732151 (+) | 240 | WP_002950439.1 | D-alanine--poly(phosphoribitol) ligase subunit DltC | - |
| CW339_RS03925 (CW339_03925) | dltD | 732144..733412 (+) | 1269 | WP_011681024.1 | D-alanyl-lipoteichoic acid biosynthesis protein DltD | - |
| CW339_RS03930 (CW339_03930) | - | 733465..734814 (-) | 1350 | Protein_721 | IS3 family transposase | - |
| CW339_RS03935 (CW339_03935) | - | 735013..737649 (-) | 2637 | WP_014621434.1 | calcium-translocating P-type ATPase, PMCA-type | - |
| CW339_RS03940 (CW339_03940) | pabB | 737826..739544 (-) | 1719 | WP_014608193.1 | aminodeoxychorismate synthase component I | - |
| CW339_RS09825 | prx | 739964..740125 (-) | 162 | WP_014727422.1 | hypothetical protein | Regulator |
| CW339_RS03950 (CW339_03950) | - | 740609..740884 (-) | 276 | WP_014727423.1 | hypothetical protein | - |
| CW339_RS03955 (CW339_03955) | - | 740901..741086 (-) | 186 | WP_024704073.1 | hypothetical protein | - |
| CW339_RS03960 (CW339_03960) | - | 741384..742889 (-) | 1506 | WP_024704074.1 | DNA primase family protein | - |
| CW339_RS03965 (CW339_03965) | - | 742879..743739 (-) | 861 | WP_024704075.1 | primase alpha helix C-terminal domain-containing protein | - |
| CW339_RS03970 (CW339_03970) | - | 743754..744026 (-) | 273 | WP_011227098.1 | MerR family transcriptional regulator | - |
| CW339_RS03980 (CW339_03980) | - | 744269..744505 (-) | 237 | WP_024704076.1 | hypothetical protein | - |
| CW339_RS03985 (CW339_03985) | - | 744519..744713 (-) | 195 | WP_024704077.1 | hypothetical protein | - |
| CW339_RS03990 (CW339_03990) | - | 744717..745010 (-) | 294 | WP_024704078.1 | hypothetical protein | - |
| CW339_RS03995 (CW339_03995) | - | 745249..745446 (-) | 198 | WP_014608200.1 | helix-turn-helix transcriptional regulator | - |
| CW339_RS04000 (CW339_04000) | - | 745609..746121 (+) | 513 | WP_014608201.1 | helix-turn-helix transcriptional regulator | - |
| CW339_RS04005 (CW339_04005) | - | 746204..747370 (+) | 1167 | WP_011227104.1 | site-specific integrase | - |
| CW339_RS04010 (CW339_04010) | - | 747486..747821 (+) | 336 | WP_002948199.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 53 a.a. Molecular weight: 6084.95 Da Isoelectric Point: 4.2412
>NTDB_id=258893 CW339_RS09825 WP_014727422.1 739964..740125(-) (prx) [Streptococcus thermophilus strain DGCC 7710]
MLTYDEFKEAMDKGFIKGDTVQIVRLDGEQVEPREILSLEKVSDIIKELGKDN
MLTYDEFKEAMDKGFIKGDTVQIVRLDGEQVEPREILSLEKVSDIIKELGKDN
Nucleotide
Download Length: 162 bp
>NTDB_id=258893 CW339_RS09825 WP_014727422.1 739964..740125(-) (prx) [Streptococcus thermophilus strain DGCC 7710]
ATGCTGACTTATGATGAATTTAAAGAGGCAATGGACAAGGGTTTTATTAAAGGTGATACTGTCCAGATTGTCCGATTAGA
CGGTGAACAAGTTGAGCCACGCGAAATATTGAGCTTAGAAAAGGTATCGGATATAATAAAGGAACTAGGCAAGGACAACT
AA
ATGCTGACTTATGATGAATTTAAAGAGGCAATGGACAAGGGTTTTATTAAAGGTGATACTGTCCAGATTGTCCGATTAGA
CGGTGAACAAGTTGAGCCACGCGAAATATTGAGCTTAGAAAAGGTATCGGATATAATAAAGGAACTAGGCAAGGACAACT
AA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
48.333 |
100 |
0.547 |
| prx | Streptococcus pyogenes MGAS315 |
46.667 |
100 |
0.528 |
| prx | Streptococcus pyogenes MGAS315 |
46.667 |
100 |
0.528 |
| prx | Streptococcus pyogenes MGAS315 |
45 |
100 |
0.509 |
| prx | Streptococcus pyogenes MGAS315 |
56.818 |
83.019 |
0.472 |
| prx | Streptococcus pyogenes MGAS315 |
57.143 |
79.245 |
0.453 |
| prx | Streptococcus pyogenes MGAS315 |
60.526 |
71.698 |
0.434 |