Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS9429_RS06855 | Genome accession | NC_008021 |
| Coordinates | 1379796..1379975 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes MGAS9429 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1379796..1420413 | 1379796..1379975 | within | 0 |
Gene organization within MGE regions
Location: 1379796..1420413
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS9429_RS06855 (MGAS9429_Spy1416) | prx | 1379796..1379975 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| MGAS9429_RS06860 (MGAS9429_Spy1417) | sda1 | 1380214..1381386 (+) | 1173 | WP_011527722.1 | streptodornase Sda1 | - |
| MGAS9429_RS06865 (MGAS9429_Spy1418) | - | 1381502..1382698 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| MGAS9429_RS06875 (MGAS9429_Spy1419) | - | 1382809..1382994 (-) | 186 | WP_002988802.1 | holin | - |
| MGAS9429_RS06880 (MGAS9429_Spy1420) | - | 1382991..1383290 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| MGAS9429_RS06885 (MGAS9429_Spy1421) | - | 1383301..1383921 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| MGAS9429_RS09395 (MGAS9429_Spy1422) | - | 1383924..1384085 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| MGAS9429_RS06890 (MGAS9429_Spy1423) | - | 1384094..1386001 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| MGAS9429_RS06895 (MGAS9429_Spy1424) | - | 1386012..1386647 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| MGAS9429_RS06900 (MGAS9429_Spy1425) | - | 1386647..1387702 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| MGAS9429_RS06905 (MGAS9429_Spy1426) | - | 1387699..1389681 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| MGAS9429_RS06910 (MGAS9429_Spy1427) | - | 1389691..1390533 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| MGAS9429_RS06915 (MGAS9429_Spy1428) | - | 1390545..1394927 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| MGAS9429_RS06920 (MGAS9429_Spy1429) | - | 1394942..1395175 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| MGAS9429_RS06925 (MGAS9429_Spy1430) | - | 1395250..1395705 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| MGAS9429_RS06930 (MGAS9429_Spy1431) | - | 1395759..1396358 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| MGAS9429_RS06935 (MGAS9429_Spy1432) | - | 1396370..1396729 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| MGAS9429_RS06940 (MGAS9429_Spy1433) | - | 1396733..1397077 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MGAS9429_RS06945 (MGAS9429_Spy1434) | - | 1397074..1397352 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| MGAS9429_RS06950 (MGAS9429_Spy1435) | - | 1397363..1397719 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| MGAS9429_RS06955 (MGAS9429_Spy1436) | - | 1397731..1398618 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| MGAS9429_RS06960 (MGAS9429_Spy1437) | - | 1398631..1399200 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| MGAS9429_RS06965 (MGAS9429_Spy1438) | - | 1399356..1399622 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| MGAS9429_RS06970 (MGAS9429_Spy1439) | - | 1399625..1399813 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| MGAS9429_RS06975 (MGAS9429_Spy1440) | - | 1399844..1401289 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| MGAS9429_RS06980 (MGAS9429_Spy1441) | - | 1401249..1402781 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| MGAS9429_RS06985 (MGAS9429_Spy1442) | - | 1402797..1404074 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| MGAS9429_RS06990 (MGAS9429_Spy1443) | - | 1404064..1404516 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| MGAS9429_RS06995 (MGAS9429_Spy1444) | - | 1404606..1405022 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| MGAS9429_RS07000 (MGAS9429_Spy1445) | - | 1405019..1405210 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| MGAS9429_RS07005 (MGAS9429_Spy1446) | - | 1405200..1406051 (-) | 852 | WP_002988740.1 | DNA-methyltransferase | - |
| MGAS9429_RS07010 (MGAS9429_Spy1447) | - | 1406060..1406326 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| MGAS9429_RS09780 (MGAS9429_Spy1448) | - | 1406323..1406490 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| MGAS9429_RS07015 (MGAS9429_Spy1449) | - | 1406491..1407813 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| MGAS9429_RS07020 (MGAS9429_Spy1450) | - | 1407810..1408085 (-) | 276 | WP_032461521.1 | VRR-NUC domain-containing protein | - |
| MGAS9429_RS07025 (MGAS9429_Spy1451) | - | 1408472..1410856 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| MGAS9429_RS07030 (MGAS9429_Spy1452) | - | 1410861..1412783 (-) | 1923 | WP_011527726.1 | DNA polymerase | - |
| MGAS9429_RS07035 (MGAS9429_Spy1453) | - | 1412826..1413383 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| MGAS9429_RS07040 (MGAS9429_Spy1454) | - | 1413394..1413792 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| MGAS9429_RS07045 (MGAS9429_Spy1455) | - | 1413796..1414950 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| MGAS9429_RS07050 (MGAS9429_Spy1456) | - | 1414950..1415249 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| MGAS9429_RS07055 (MGAS9429_Spy1457) | - | 1415337..1415540 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| MGAS9429_RS07060 (MGAS9429_Spy1459) | - | 1415686..1416072 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| MGAS9429_RS07065 (MGAS9429_Spy1460) | - | 1416069..1416272 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| MGAS9429_RS09400 (MGAS9429_Spy1461) | - | 1416265..1416435 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| MGAS9429_RS07070 (MGAS9429_Spy1462) | - | 1416432..1416707 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| MGAS9429_RS07075 (MGAS9429_Spy1463) | - | 1416769..1416984 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| MGAS9429_RS07080 (MGAS9429_Spy1464) | - | 1417032..1417445 (+) | 414 | WP_032461522.1 | hypothetical protein | - |
| MGAS9429_RS09785 (MGAS9429_Spy1465) | - | 1417430..1417582 (-) | 153 | WP_011527730.1 | hypothetical protein | - |
| MGAS9429_RS07085 (MGAS9429_Spy1466) | - | 1417908..1418258 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| MGAS9429_RS07090 (MGAS9429_Spy1467) | - | 1418272..1418655 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MGAS9429_RS07095 (MGAS9429_Spy1468) | - | 1418666..1419217 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| MGAS9429_RS07100 (MGAS9429_Spy1469) | - | 1419334..1420413 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=25862 MGAS9429_RS06855 WP_002988813.1 1379796..1379975(-) (prx) [Streptococcus pyogenes MGAS9429]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=25862 MGAS9429_RS06855 WP_002988813.1 1379796..1379975(-) (prx) [Streptococcus pyogenes MGAS9429]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |