Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | CWQ20_RS00895 | Genome accession | NZ_CP025029 |
| Coordinates | 119235..119417 (+) | Length | 60 a.a. |
| NCBI ID | WP_017647839.1 | Uniprot ID | - |
| Organism | Streptococcus agalactiae strain SGEHI2015-25 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 81735..120322 | 119235..119417 | within | 0 |
Gene organization within MGE regions
Location: 81735..120322
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CWQ20_RS00635 (CWQ20_00635) | - | 81735..82832 (-) | 1098 | WP_000570848.1 | site-specific integrase | - |
| CWQ20_RS00640 (CWQ20_00640) | - | 83009..83218 (-) | 210 | WP_000520183.1 | TM2 domain-containing protein | - |
| CWQ20_RS00645 (CWQ20_00645) | - | 83271..83651 (-) | 381 | WP_000686776.1 | ImmA/IrrE family metallo-endopeptidase | - |
| CWQ20_RS00650 (CWQ20_00650) | - | 83641..84000 (-) | 360 | WP_000207087.1 | helix-turn-helix domain-containing protein | - |
| CWQ20_RS00655 (CWQ20_00655) | - | 84189..84389 (+) | 201 | WP_001875236.1 | helix-turn-helix transcriptional regulator | - |
| CWQ20_RS00660 (CWQ20_00660) | - | 84437..85165 (+) | 729 | WP_017647877.1 | phage antirepressor KilAC domain-containing protein | - |
| CWQ20_RS10890 | - | 85198..85356 (+) | 159 | WP_017647876.1 | hypothetical protein | - |
| CWQ20_RS10860 | - | 85353..85646 (-) | 294 | WP_001104373.1 | hypothetical protein | - |
| CWQ20_RS00665 (CWQ20_00665) | - | 85775..86032 (+) | 258 | WP_001191791.1 | hypothetical protein | - |
| CWQ20_RS10895 | - | 86062..86205 (+) | 144 | WP_017647875.1 | hypothetical protein | - |
| CWQ20_RS00670 (CWQ20_00670) | - | 86234..86992 (+) | 759 | WP_000546751.1 | DnaD domain protein | - |
| CWQ20_RS00675 (CWQ20_00675) | - | 86979..87761 (+) | 783 | WP_000600244.1 | ATP-binding protein | - |
| CWQ20_RS10900 | - | 87752..87895 (+) | 144 | WP_017647874.1 | hypothetical protein | - |
| CWQ20_RS00680 (CWQ20_00680) | - | 87888..88163 (+) | 276 | WP_017647873.1 | hypothetical protein | - |
| CWQ20_RS00685 (CWQ20_00685) | - | 88150..88398 (+) | 249 | WP_053515066.1 | hypothetical protein | - |
| CWQ20_RS00690 (CWQ20_00690) | - | 88399..89352 (+) | 954 | WP_000064172.1 | recombinase RecT | - |
| CWQ20_RS00695 (CWQ20_00695) | - | 89349..90146 (+) | 798 | WP_017647870.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| CWQ20_RS00700 (CWQ20_00700) | - | 90309..90506 (+) | 198 | WP_017647869.1 | hypothetical protein | - |
| CWQ20_RS00705 (CWQ20_00705) | - | 90496..90972 (+) | 477 | WP_017647868.1 | RusA family crossover junction endodeoxyribonuclease | - |
| CWQ20_RS00710 (CWQ20_00710) | - | 90962..91309 (+) | 348 | WP_017647944.1 | hypothetical protein | - |
| CWQ20_RS00715 (CWQ20_00715) | - | 91321..91617 (+) | 297 | WP_017647866.1 | nucleotide modification associated domain-containing protein | - |
| CWQ20_RS10905 | - | 91601..91759 (+) | 159 | WP_017647865.1 | hypothetical protein | - |
| CWQ20_RS00720 (CWQ20_00720) | - | 91756..92139 (+) | 384 | WP_017647864.1 | YopX family protein | - |
| CWQ20_RS00725 (CWQ20_00725) | - | 92136..92300 (+) | 165 | WP_017647863.1 | hypothetical protein | - |
| CWQ20_RS00730 (CWQ20_00730) | - | 92297..92566 (+) | 270 | WP_017647862.1 | hypothetical protein | - |
| CWQ20_RS00735 (CWQ20_00735) | - | 92569..93054 (+) | 486 | WP_017647943.1 | class I SAM-dependent methyltransferase | - |
| CWQ20_RS00740 (CWQ20_00740) | - | 93044..93550 (+) | 507 | WP_225971862.1 | hypothetical protein | - |
| CWQ20_RS00745 (CWQ20_00745) | - | 93554..94081 (+) | 528 | WP_017647942.1 | DUF1642 domain-containing protein | - |
| CWQ20_RS00750 (CWQ20_00750) | - | 94102..94401 (+) | 300 | WP_001105090.1 | hypothetical protein | - |
| CWQ20_RS00755 (CWQ20_00755) | - | 94419..94685 (+) | 267 | WP_017647858.1 | hypothetical protein | - |
| CWQ20_RS00760 (CWQ20_00760) | - | 95074..95499 (+) | 426 | WP_000533372.1 | DUF1492 domain-containing protein | - |
| CWQ20_RS00765 (CWQ20_00765) | - | 95793..96170 (+) | 378 | WP_000225343.1 | HNH endonuclease | - |
| CWQ20_RS00770 (CWQ20_00770) | - | 96322..96678 (+) | 357 | WP_000725957.1 | hypothetical protein | - |
| CWQ20_RS00775 (CWQ20_00775) | - | 96675..97943 (+) | 1269 | WP_001108671.1 | phage portal protein | - |
| CWQ20_RS00780 (CWQ20_00780) | - | 97936..99156 (+) | 1221 | WP_000227332.1 | polymorphic toxin type 50 domain-containing protein | - |
| CWQ20_RS00785 (CWQ20_00785) | - | 99156..99344 (+) | 189 | WP_000421992.1 | hypothetical protein | - |
| CWQ20_RS00790 (CWQ20_00790) | - | 99453..100868 (+) | 1416 | WP_000256853.1 | terminase large subunit | - |
| CWQ20_RS00795 (CWQ20_00795) | - | 100949..101413 (+) | 465 | WP_001288695.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| CWQ20_RS00800 (CWQ20_00800) | - | 101416..102318 (+) | 903 | WP_100831564.1 | phage major capsid protein | - |
| CWQ20_RS00805 (CWQ20_00805) | - | 102315..102530 (+) | 216 | WP_000640308.1 | hypothetical protein | - |
| CWQ20_RS00810 (CWQ20_00810) | - | 102544..102966 (+) | 423 | WP_000180798.1 | phage Gp19/Gp15/Gp42 family protein | - |
| CWQ20_RS00815 (CWQ20_00815) | - | 102926..103264 (+) | 339 | WP_025194588.1 | hypothetical protein | - |
| CWQ20_RS00820 (CWQ20_00820) | - | 103257..103493 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| CWQ20_RS00825 (CWQ20_00825) | - | 103494..103829 (+) | 336 | WP_000573598.1 | hypothetical protein | - |
| CWQ20_RS00830 (CWQ20_00830) | - | 103839..104396 (+) | 558 | WP_000226353.1 | tail protein | - |
| CWQ20_RS00835 (CWQ20_00835) | - | 104396..104641 (+) | 246 | WP_000858406.1 | hypothetical protein | - |
| CWQ20_RS00840 (CWQ20_00840) | - | 104656..105027 (+) | 372 | WP_000916437.1 | DUF5361 domain-containing protein | - |
| CWQ20_RS00845 (CWQ20_00845) | - | 105027..107039 (+) | 2013 | WP_053515065.1 | phage tail protein | - |
| CWQ20_RS00850 (CWQ20_00850) | - | 107033..108565 (+) | 1533 | WP_000228809.1 | distal tail protein Dit | - |
| CWQ20_RS00855 (CWQ20_00855) | - | 108566..113521 (+) | 4956 | WP_100831565.1 | glucosaminidase domain-containing protein | - |
| CWQ20_RS00860 (CWQ20_00860) | - | 113522..115525 (+) | 2004 | WP_053515051.1 | DUF859 family phage minor structural protein | - |
| CWQ20_RS00865 (CWQ20_00865) | - | 115537..115929 (+) | 393 | WP_000889196.1 | DUF1366 domain-containing protein | - |
| CWQ20_RS11100 | - | 115952..116080 (+) | 129 | WP_017647842.1 | hypothetical protein | - |
| CWQ20_RS00870 (CWQ20_00870) | - | 116089..116391 (+) | 303 | WP_017647841.1 | hypothetical protein | - |
| CWQ20_RS00875 (CWQ20_00875) | - | 116384..116611 (+) | 228 | WP_000609111.1 | phage holin | - |
| CWQ20_RS00880 (CWQ20_00880) | - | 116737..118071 (+) | 1335 | WP_017647840.1 | GH25 family lysozyme | - |
| CWQ20_RS00885 (CWQ20_00885) | - | 118215..118466 (-) | 252 | WP_000455662.1 | hypothetical protein | - |
| CWQ20_RS10910 | - | 118607..118753 (-) | 147 | WP_001030869.1 | hypothetical protein | - |
| CWQ20_RS00890 (CWQ20_00890) | - | 118903..119112 (+) | 210 | WP_000424774.1 | helix-turn-helix domain-containing protein | - |
| CWQ20_RS00895 (CWQ20_00895) | prx | 119235..119417 (+) | 183 | WP_017647839.1 | hypothetical protein | Regulator |
| CWQ20_RS00900 (CWQ20_00900) | - | 119630..120322 (+) | 693 | WP_000049272.1 | histidine phosphatase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6933.00 Da Isoelectric Point: 4.2702
>NTDB_id=257411 CWQ20_RS00895 WP_017647839.1 119235..119417(+) (prx) [Streptococcus agalactiae strain SGEHI2015-25]
MLYIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELDK
MLYIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=257411 CWQ20_RS00895 WP_017647839.1 119235..119417(+) (prx) [Streptococcus agalactiae strain SGEHI2015-25]
ATGTTGTATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA
ATGTTGTATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS8232 |
70 |
100 |
0.7 |
| prx | Streptococcus pyogenes MGAS315 |
68.333 |
100 |
0.683 |
| prx | Streptococcus pyogenes MGAS315 |
65 |
100 |
0.65 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
80.488 |
68.333 |
0.55 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
68.333 |
0.5 |