Detailed information    

insolico Bioinformatically predicted

Overview


Name   prx   Type   Regulator
Locus tag   CWQ21_RS06330 Genome accession   NZ_CP025028
Coordinates   1185091..1185273 (-) Length   60 a.a.
NCBI ID   WP_017647839.1    Uniprot ID   -
Organism   Streptococcus agalactiae strain SGEHI2015-95     
Function   Inhibit ComR activation (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1185091..1237290 1185091..1185273 within 0


Gene organization within MGE regions


Location: 1185091..1237290
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CWQ21_RS06330 (CWQ21_06330) prx 1185091..1185273 (-) 183 WP_017647839.1 hypothetical protein Regulator
  CWQ21_RS06335 (CWQ21_06335) - 1185396..1185605 (-) 210 WP_000424774.1 helix-turn-helix transcriptional regulator -
  CWQ21_RS11310 - 1185755..1185901 (+) 147 WP_001030869.1 hypothetical protein -
  CWQ21_RS06340 (CWQ21_06340) - 1186042..1186293 (+) 252 WP_000455662.1 hypothetical protein -
  CWQ21_RS06345 (CWQ21_06345) - 1186437..1187771 (-) 1335 WP_017647840.1 GH25 family lysozyme -
  CWQ21_RS06350 (CWQ21_06350) - 1187897..1188124 (-) 228 WP_000609111.1 phage holin -
  CWQ21_RS06355 (CWQ21_06355) - 1188117..1188419 (-) 303 WP_017647841.1 hypothetical protein -
  CWQ21_RS11525 - 1188428..1188556 (-) 129 WP_017647842.1 hypothetical protein -
  CWQ21_RS06360 (CWQ21_06360) - 1188579..1188971 (-) 393 WP_000889196.1 DUF1366 domain-containing protein -
  CWQ21_RS06365 (CWQ21_06365) - 1188983..1190986 (-) 2004 WP_053515051.1 DUF859 family phage minor structural protein -
  CWQ21_RS06370 (CWQ21_06370) - 1190987..1195108 (-) 4122 WP_053515064.1 glucosaminidase domain-containing protein -
  CWQ21_RS06375 (CWQ21_06375) - 1195109..1196641 (-) 1533 WP_000228809.1 distal tail protein Dit -
  CWQ21_RS06380 (CWQ21_06380) - 1196635..1198647 (-) 2013 WP_053515065.1 PblA -
  CWQ21_RS06385 (CWQ21_06385) - 1198647..1199018 (-) 372 WP_000916437.1 DUF5361 domain-containing protein -
  CWQ21_RS06390 (CWQ21_06390) - 1199033..1199278 (-) 246 WP_000858406.1 hypothetical protein -
  CWQ21_RS06395 (CWQ21_06395) - 1199278..1199835 (-) 558 WP_000226353.1 tail protein -
  CWQ21_RS06400 (CWQ21_06400) - 1199845..1200180 (-) 336 WP_000573598.1 hypothetical protein -
  CWQ21_RS06405 (CWQ21_06405) - 1200181..1200417 (-) 237 WP_000032787.1 hypothetical protein -
  CWQ21_RS06410 (CWQ21_06410) - 1200410..1200748 (-) 339 WP_025194588.1 hypothetical protein -
  CWQ21_RS06415 (CWQ21_06415) - 1200708..1201130 (-) 423 WP_000180798.1 phage Gp19/Gp15/Gp42 family protein -
  CWQ21_RS06420 (CWQ21_06420) - 1201144..1201359 (-) 216 WP_000640308.1 hypothetical protein -
  CWQ21_RS06425 (CWQ21_06425) - 1201356..1202258 (-) 903 WP_000841023.1 phage major capsid protein -
  CWQ21_RS06430 (CWQ21_06430) - 1202261..1202725 (-) 465 WP_001288695.1 DUF4355 domain-containing protein -
  CWQ21_RS06435 (CWQ21_06435) - 1202806..1204221 (-) 1416 WP_000256853.1 terminase large subunit -
  CWQ21_RS06440 (CWQ21_06440) - 1204330..1204518 (-) 189 WP_000421992.1 hypothetical protein -
  CWQ21_RS06445 (CWQ21_06445) - 1204518..1205738 (-) 1221 WP_000227332.1 polymorphic toxin type 50 domain-containing protein -
  CWQ21_RS06450 (CWQ21_06450) - 1205731..1206999 (-) 1269 WP_001108671.1 phage portal protein -
  CWQ21_RS06455 (CWQ21_06455) - 1206996..1207352 (-) 357 WP_000725957.1 hypothetical protein -
  CWQ21_RS06460 (CWQ21_06460) - 1207504..1207881 (-) 378 WP_000225343.1 HNH endonuclease signature motif containing protein -
  CWQ21_RS06465 (CWQ21_06465) - 1208175..1208600 (-) 426 WP_000533372.1 DUF1492 domain-containing protein -
  CWQ21_RS06470 (CWQ21_06470) - 1208989..1209255 (-) 267 WP_017647858.1 hypothetical protein -
  CWQ21_RS06475 (CWQ21_06475) - 1209273..1209572 (-) 300 WP_001105090.1 hypothetical protein -
  CWQ21_RS06480 (CWQ21_06480) - 1209593..1210120 (-) 528 WP_017647942.1 DUF1642 domain-containing protein -
  CWQ21_RS06485 (CWQ21_06485) - 1210124..1210630 (-) 507 WP_225971862.1 hypothetical protein -
  CWQ21_RS06490 (CWQ21_06490) - 1210620..1211105 (-) 486 WP_017647943.1 class I SAM-dependent methyltransferase -
  CWQ21_RS06495 (CWQ21_06495) - 1211108..1211377 (-) 270 WP_017647862.1 hypothetical protein -
  CWQ21_RS06500 (CWQ21_06500) - 1211374..1211538 (-) 165 WP_017647863.1 hypothetical protein -
  CWQ21_RS06505 (CWQ21_06505) - 1211535..1211918 (-) 384 WP_017647864.1 YopX family protein -
  CWQ21_RS11315 - 1211915..1212073 (-) 159 WP_017647865.1 hypothetical protein -
  CWQ21_RS06510 (CWQ21_06510) - 1212057..1212353 (-) 297 WP_017647866.1 nucleotide modification associated domain-containing protein -
  CWQ21_RS06515 (CWQ21_06515) - 1212365..1212712 (-) 348 WP_017647944.1 hypothetical protein -
  CWQ21_RS06520 (CWQ21_06520) - 1212702..1213178 (-) 477 WP_017647868.1 RusA family crossover junction endodeoxyribonuclease -
  CWQ21_RS06525 (CWQ21_06525) - 1213168..1213365 (-) 198 WP_017647869.1 hypothetical protein -
  CWQ21_RS06530 (CWQ21_06530) - 1213528..1214325 (-) 798 WP_017647870.1 PD-(D/E)XK nuclease-like domain-containing protein -
  CWQ21_RS06535 (CWQ21_06535) - 1214322..1215275 (-) 954 WP_000064172.1 RecT family recombinase -
  CWQ21_RS06540 (CWQ21_06540) - 1215276..1215524 (-) 249 WP_053515066.1 hypothetical protein -
  CWQ21_RS06545 (CWQ21_06545) - 1215511..1215786 (-) 276 WP_017647873.1 hypothetical protein -
  CWQ21_RS11320 - 1215779..1215922 (-) 144 WP_017647874.1 hypothetical protein -
  CWQ21_RS06550 (CWQ21_06550) - 1215913..1216695 (-) 783 WP_000600244.1 ATP-binding protein -
  CWQ21_RS06555 (CWQ21_06555) - 1216682..1217440 (-) 759 WP_000546751.1 DnaD domain protein -
  CWQ21_RS11325 - 1217469..1217612 (-) 144 WP_017647875.1 hypothetical protein -
  CWQ21_RS06560 (CWQ21_06560) - 1217642..1217899 (-) 258 WP_001191791.1 hypothetical protein -
  CWQ21_RS11245 - 1218028..1218321 (+) 294 WP_001104373.1 hypothetical protein -
  CWQ21_RS11330 - 1218318..1218476 (-) 159 WP_017647876.1 hypothetical protein -
  CWQ21_RS06565 (CWQ21_06565) - 1218509..1219237 (-) 729 WP_017647877.1 phage antirepressor KilAC domain-containing protein -
  CWQ21_RS06570 (CWQ21_06570) - 1219285..1219485 (-) 201 WP_001875236.1 helix-turn-helix transcriptional regulator -
  CWQ21_RS06575 (CWQ21_06575) - 1219674..1220033 (+) 360 WP_000207087.1 helix-turn-helix domain-containing protein -
  CWQ21_RS06580 (CWQ21_06580) - 1220023..1220403 (+) 381 WP_000686776.1 ImmA/IrrE family metallo-endopeptidase -
  CWQ21_RS06585 (CWQ21_06585) - 1220456..1220665 (+) 210 WP_000520183.1 TM2 domain-containing protein -
  CWQ21_RS06590 (CWQ21_06590) - 1220842..1221939 (+) 1098 WP_000570848.1 site-specific integrase -
  CWQ21_RS06595 (CWQ21_06595) hylB 1222218..1225436 (+) 3219 WP_017647747.1 hyaluronate lyase -
  CWQ21_RS06600 (CWQ21_06600) rfbB 1225488..1226534 (-) 1047 WP_000134282.1 dTDP-glucose 4,6-dehydratase -
  CWQ21_RS06605 (CWQ21_06605) - 1226741..1227333 (-) 593 Protein_1207 dTDP-4-dehydrorhamnose 3,5-epimerase family protein -
  CWQ21_RS06610 (CWQ21_06610) rfbA 1227333..1228202 (-) 870 WP_000676114.1 glucose-1-phosphate thymidylyltransferase RfbA -
  CWQ21_RS06615 (CWQ21_06615) - 1228261..1229364 (-) 1104 WP_000716829.1 FAD-dependent oxidoreductase -
  CWQ21_RS06620 (CWQ21_06620) - 1229373..1230161 (-) 789 WP_000647415.1 Nif3-like dinuclear metal center hexameric protein -
  CWQ21_RS06625 (CWQ21_06625) - 1230151..1230834 (-) 684 WP_000365673.1 tRNA (adenine(22)-N(1))-methyltransferase TrmK -
  CWQ21_RS06630 (CWQ21_06630) - 1230937..1231617 (-) 681 WP_000221657.1 DnaD domain-containing protein -
  CWQ21_RS06635 (CWQ21_06635) - 1231735..1232253 (-) 519 WP_000365343.1 adenine phosphoribosyltransferase -
  CWQ21_RS06640 (CWQ21_06640) - 1232376..1234940 (-) 2565 WP_017647748.1 GBS Bsp-like repeat-containing protein -
  CWQ21_RS06650 (CWQ21_06650) recJ 1235092..1237290 (-) 2199 WP_000622242.1 single-stranded-DNA-specific exonuclease RecJ -

Sequence


Protein


Download         Length: 60 a.a.        Molecular weight: 6933.00 Da        Isoelectric Point: 4.2702

>NTDB_id=257395 CWQ21_RS06330 WP_017647839.1 1185091..1185273(-) (prx) [Streptococcus agalactiae strain SGEHI2015-95]
MLYIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELDK

Nucleotide


Download         Length: 183 bp        

>NTDB_id=257395 CWQ21_RS06330 WP_017647839.1 1185091..1185273(-) (prx) [Streptococcus agalactiae strain SGEHI2015-95]
ATGTTGTATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  prx Streptococcus pyogenes MGAS315

73.333

100

0.733

  prx Streptococcus pyogenes MGAS8232

70

100

0.7

  prx Streptococcus pyogenes MGAS315

68.333

100

0.683

  prx Streptococcus pyogenes MGAS315

65

100

0.65

  prx Streptococcus pyogenes MGAS315

90.244

68.333

0.617

  prx Streptococcus pyogenes MGAS315

80.488

68.333

0.55

  prx Streptococcus pyogenes MGAS315

73.171

68.333

0.5


Multiple sequence alignment