Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | CWQ21_RS06330 | Genome accession | NZ_CP025028 |
| Coordinates | 1185091..1185273 (-) | Length | 60 a.a. |
| NCBI ID | WP_017647839.1 | Uniprot ID | - |
| Organism | Streptococcus agalactiae strain SGEHI2015-95 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1185091..1237290 | 1185091..1185273 | within | 0 |
Gene organization within MGE regions
Location: 1185091..1237290
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CWQ21_RS06330 (CWQ21_06330) | prx | 1185091..1185273 (-) | 183 | WP_017647839.1 | hypothetical protein | Regulator |
| CWQ21_RS06335 (CWQ21_06335) | - | 1185396..1185605 (-) | 210 | WP_000424774.1 | helix-turn-helix transcriptional regulator | - |
| CWQ21_RS11310 | - | 1185755..1185901 (+) | 147 | WP_001030869.1 | hypothetical protein | - |
| CWQ21_RS06340 (CWQ21_06340) | - | 1186042..1186293 (+) | 252 | WP_000455662.1 | hypothetical protein | - |
| CWQ21_RS06345 (CWQ21_06345) | - | 1186437..1187771 (-) | 1335 | WP_017647840.1 | GH25 family lysozyme | - |
| CWQ21_RS06350 (CWQ21_06350) | - | 1187897..1188124 (-) | 228 | WP_000609111.1 | phage holin | - |
| CWQ21_RS06355 (CWQ21_06355) | - | 1188117..1188419 (-) | 303 | WP_017647841.1 | hypothetical protein | - |
| CWQ21_RS11525 | - | 1188428..1188556 (-) | 129 | WP_017647842.1 | hypothetical protein | - |
| CWQ21_RS06360 (CWQ21_06360) | - | 1188579..1188971 (-) | 393 | WP_000889196.1 | DUF1366 domain-containing protein | - |
| CWQ21_RS06365 (CWQ21_06365) | - | 1188983..1190986 (-) | 2004 | WP_053515051.1 | DUF859 family phage minor structural protein | - |
| CWQ21_RS06370 (CWQ21_06370) | - | 1190987..1195108 (-) | 4122 | WP_053515064.1 | glucosaminidase domain-containing protein | - |
| CWQ21_RS06375 (CWQ21_06375) | - | 1195109..1196641 (-) | 1533 | WP_000228809.1 | distal tail protein Dit | - |
| CWQ21_RS06380 (CWQ21_06380) | - | 1196635..1198647 (-) | 2013 | WP_053515065.1 | PblA | - |
| CWQ21_RS06385 (CWQ21_06385) | - | 1198647..1199018 (-) | 372 | WP_000916437.1 | DUF5361 domain-containing protein | - |
| CWQ21_RS06390 (CWQ21_06390) | - | 1199033..1199278 (-) | 246 | WP_000858406.1 | hypothetical protein | - |
| CWQ21_RS06395 (CWQ21_06395) | - | 1199278..1199835 (-) | 558 | WP_000226353.1 | tail protein | - |
| CWQ21_RS06400 (CWQ21_06400) | - | 1199845..1200180 (-) | 336 | WP_000573598.1 | hypothetical protein | - |
| CWQ21_RS06405 (CWQ21_06405) | - | 1200181..1200417 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| CWQ21_RS06410 (CWQ21_06410) | - | 1200410..1200748 (-) | 339 | WP_025194588.1 | hypothetical protein | - |
| CWQ21_RS06415 (CWQ21_06415) | - | 1200708..1201130 (-) | 423 | WP_000180798.1 | phage Gp19/Gp15/Gp42 family protein | - |
| CWQ21_RS06420 (CWQ21_06420) | - | 1201144..1201359 (-) | 216 | WP_000640308.1 | hypothetical protein | - |
| CWQ21_RS06425 (CWQ21_06425) | - | 1201356..1202258 (-) | 903 | WP_000841023.1 | phage major capsid protein | - |
| CWQ21_RS06430 (CWQ21_06430) | - | 1202261..1202725 (-) | 465 | WP_001288695.1 | DUF4355 domain-containing protein | - |
| CWQ21_RS06435 (CWQ21_06435) | - | 1202806..1204221 (-) | 1416 | WP_000256853.1 | terminase large subunit | - |
| CWQ21_RS06440 (CWQ21_06440) | - | 1204330..1204518 (-) | 189 | WP_000421992.1 | hypothetical protein | - |
| CWQ21_RS06445 (CWQ21_06445) | - | 1204518..1205738 (-) | 1221 | WP_000227332.1 | polymorphic toxin type 50 domain-containing protein | - |
| CWQ21_RS06450 (CWQ21_06450) | - | 1205731..1206999 (-) | 1269 | WP_001108671.1 | phage portal protein | - |
| CWQ21_RS06455 (CWQ21_06455) | - | 1206996..1207352 (-) | 357 | WP_000725957.1 | hypothetical protein | - |
| CWQ21_RS06460 (CWQ21_06460) | - | 1207504..1207881 (-) | 378 | WP_000225343.1 | HNH endonuclease signature motif containing protein | - |
| CWQ21_RS06465 (CWQ21_06465) | - | 1208175..1208600 (-) | 426 | WP_000533372.1 | DUF1492 domain-containing protein | - |
| CWQ21_RS06470 (CWQ21_06470) | - | 1208989..1209255 (-) | 267 | WP_017647858.1 | hypothetical protein | - |
| CWQ21_RS06475 (CWQ21_06475) | - | 1209273..1209572 (-) | 300 | WP_001105090.1 | hypothetical protein | - |
| CWQ21_RS06480 (CWQ21_06480) | - | 1209593..1210120 (-) | 528 | WP_017647942.1 | DUF1642 domain-containing protein | - |
| CWQ21_RS06485 (CWQ21_06485) | - | 1210124..1210630 (-) | 507 | WP_225971862.1 | hypothetical protein | - |
| CWQ21_RS06490 (CWQ21_06490) | - | 1210620..1211105 (-) | 486 | WP_017647943.1 | class I SAM-dependent methyltransferase | - |
| CWQ21_RS06495 (CWQ21_06495) | - | 1211108..1211377 (-) | 270 | WP_017647862.1 | hypothetical protein | - |
| CWQ21_RS06500 (CWQ21_06500) | - | 1211374..1211538 (-) | 165 | WP_017647863.1 | hypothetical protein | - |
| CWQ21_RS06505 (CWQ21_06505) | - | 1211535..1211918 (-) | 384 | WP_017647864.1 | YopX family protein | - |
| CWQ21_RS11315 | - | 1211915..1212073 (-) | 159 | WP_017647865.1 | hypothetical protein | - |
| CWQ21_RS06510 (CWQ21_06510) | - | 1212057..1212353 (-) | 297 | WP_017647866.1 | nucleotide modification associated domain-containing protein | - |
| CWQ21_RS06515 (CWQ21_06515) | - | 1212365..1212712 (-) | 348 | WP_017647944.1 | hypothetical protein | - |
| CWQ21_RS06520 (CWQ21_06520) | - | 1212702..1213178 (-) | 477 | WP_017647868.1 | RusA family crossover junction endodeoxyribonuclease | - |
| CWQ21_RS06525 (CWQ21_06525) | - | 1213168..1213365 (-) | 198 | WP_017647869.1 | hypothetical protein | - |
| CWQ21_RS06530 (CWQ21_06530) | - | 1213528..1214325 (-) | 798 | WP_017647870.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| CWQ21_RS06535 (CWQ21_06535) | - | 1214322..1215275 (-) | 954 | WP_000064172.1 | RecT family recombinase | - |
| CWQ21_RS06540 (CWQ21_06540) | - | 1215276..1215524 (-) | 249 | WP_053515066.1 | hypothetical protein | - |
| CWQ21_RS06545 (CWQ21_06545) | - | 1215511..1215786 (-) | 276 | WP_017647873.1 | hypothetical protein | - |
| CWQ21_RS11320 | - | 1215779..1215922 (-) | 144 | WP_017647874.1 | hypothetical protein | - |
| CWQ21_RS06550 (CWQ21_06550) | - | 1215913..1216695 (-) | 783 | WP_000600244.1 | ATP-binding protein | - |
| CWQ21_RS06555 (CWQ21_06555) | - | 1216682..1217440 (-) | 759 | WP_000546751.1 | DnaD domain protein | - |
| CWQ21_RS11325 | - | 1217469..1217612 (-) | 144 | WP_017647875.1 | hypothetical protein | - |
| CWQ21_RS06560 (CWQ21_06560) | - | 1217642..1217899 (-) | 258 | WP_001191791.1 | hypothetical protein | - |
| CWQ21_RS11245 | - | 1218028..1218321 (+) | 294 | WP_001104373.1 | hypothetical protein | - |
| CWQ21_RS11330 | - | 1218318..1218476 (-) | 159 | WP_017647876.1 | hypothetical protein | - |
| CWQ21_RS06565 (CWQ21_06565) | - | 1218509..1219237 (-) | 729 | WP_017647877.1 | phage antirepressor KilAC domain-containing protein | - |
| CWQ21_RS06570 (CWQ21_06570) | - | 1219285..1219485 (-) | 201 | WP_001875236.1 | helix-turn-helix transcriptional regulator | - |
| CWQ21_RS06575 (CWQ21_06575) | - | 1219674..1220033 (+) | 360 | WP_000207087.1 | helix-turn-helix domain-containing protein | - |
| CWQ21_RS06580 (CWQ21_06580) | - | 1220023..1220403 (+) | 381 | WP_000686776.1 | ImmA/IrrE family metallo-endopeptidase | - |
| CWQ21_RS06585 (CWQ21_06585) | - | 1220456..1220665 (+) | 210 | WP_000520183.1 | TM2 domain-containing protein | - |
| CWQ21_RS06590 (CWQ21_06590) | - | 1220842..1221939 (+) | 1098 | WP_000570848.1 | site-specific integrase | - |
| CWQ21_RS06595 (CWQ21_06595) | hylB | 1222218..1225436 (+) | 3219 | WP_017647747.1 | hyaluronate lyase | - |
| CWQ21_RS06600 (CWQ21_06600) | rfbB | 1225488..1226534 (-) | 1047 | WP_000134282.1 | dTDP-glucose 4,6-dehydratase | - |
| CWQ21_RS06605 (CWQ21_06605) | - | 1226741..1227333 (-) | 593 | Protein_1207 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| CWQ21_RS06610 (CWQ21_06610) | rfbA | 1227333..1228202 (-) | 870 | WP_000676114.1 | glucose-1-phosphate thymidylyltransferase RfbA | - |
| CWQ21_RS06615 (CWQ21_06615) | - | 1228261..1229364 (-) | 1104 | WP_000716829.1 | FAD-dependent oxidoreductase | - |
| CWQ21_RS06620 (CWQ21_06620) | - | 1229373..1230161 (-) | 789 | WP_000647415.1 | Nif3-like dinuclear metal center hexameric protein | - |
| CWQ21_RS06625 (CWQ21_06625) | - | 1230151..1230834 (-) | 684 | WP_000365673.1 | tRNA (adenine(22)-N(1))-methyltransferase TrmK | - |
| CWQ21_RS06630 (CWQ21_06630) | - | 1230937..1231617 (-) | 681 | WP_000221657.1 | DnaD domain-containing protein | - |
| CWQ21_RS06635 (CWQ21_06635) | - | 1231735..1232253 (-) | 519 | WP_000365343.1 | adenine phosphoribosyltransferase | - |
| CWQ21_RS06640 (CWQ21_06640) | - | 1232376..1234940 (-) | 2565 | WP_017647748.1 | GBS Bsp-like repeat-containing protein | - |
| CWQ21_RS06650 (CWQ21_06650) | recJ | 1235092..1237290 (-) | 2199 | WP_000622242.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6933.00 Da Isoelectric Point: 4.2702
>NTDB_id=257395 CWQ21_RS06330 WP_017647839.1 1185091..1185273(-) (prx) [Streptococcus agalactiae strain SGEHI2015-95]
MLYIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELDK
MLYIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=257395 CWQ21_RS06330 WP_017647839.1 1185091..1185273(-) (prx) [Streptococcus agalactiae strain SGEHI2015-95]
ATGTTGTATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA
ATGTTGTATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS8232 |
70 |
100 |
0.7 |
| prx | Streptococcus pyogenes MGAS315 |
68.333 |
100 |
0.683 |
| prx | Streptococcus pyogenes MGAS315 |
65 |
100 |
0.65 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
80.488 |
68.333 |
0.55 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
68.333 |
0.5 |