Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | CWQ21_RS00895 | Genome accession | NZ_CP025028 |
| Coordinates | 121912..122094 (+) | Length | 60 a.a. |
| NCBI ID | WP_017647839.1 | Uniprot ID | - |
| Organism | Streptococcus agalactiae strain SGEHI2015-95 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 81734..124320 | 121912..122094 | within | 0 |
Gene organization within MGE regions
Location: 81734..124320
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CWQ21_RS00635 (CWQ21_00635) | - | 81734..82831 (-) | 1098 | WP_000570848.1 | site-specific integrase | - |
| CWQ21_RS00640 (CWQ21_00640) | - | 83005..83691 (-) | 687 | WP_053515021.1 | hypothetical protein | - |
| CWQ21_RS00645 (CWQ21_00645) | - | 83700..84077 (-) | 378 | WP_053515022.1 | ImmA/IrrE family metallo-endopeptidase | - |
| CWQ21_RS00650 (CWQ21_00650) | - | 84061..84402 (-) | 342 | WP_053515023.1 | helix-turn-helix transcriptional regulator | - |
| CWQ21_RS00655 (CWQ21_00655) | - | 84598..84810 (+) | 213 | WP_053515024.1 | helix-turn-helix transcriptional regulator | - |
| CWQ21_RS00660 (CWQ21_00660) | - | 84839..85564 (+) | 726 | WP_053515025.1 | phage antirepressor KilAC domain-containing protein | - |
| CWQ21_RS11260 | - | 85597..85755 (+) | 159 | WP_017647876.1 | hypothetical protein | - |
| CWQ21_RS11230 | - | 85752..86045 (-) | 294 | WP_001104373.1 | hypothetical protein | - |
| CWQ21_RS00665 (CWQ21_00665) | - | 86174..86431 (+) | 258 | WP_001191791.1 | hypothetical protein | - |
| CWQ21_RS11265 | - | 86461..86604 (+) | 144 | WP_172798516.1 | hypothetical protein | - |
| CWQ21_RS00670 (CWQ21_00670) | - | 86680..86880 (+) | 201 | WP_001058282.1 | hypothetical protein | - |
| CWQ21_RS00675 (CWQ21_00675) | - | 86877..87167 (+) | 291 | WP_000650504.1 | hypothetical protein | - |
| CWQ21_RS00680 (CWQ21_00680) | - | 87154..87837 (+) | 684 | WP_000704951.1 | AAA family ATPase | - |
| CWQ21_RS00685 (CWQ21_00685) | - | 87843..89279 (+) | 1437 | Protein_87 | DEAD/DEAH box helicase | - |
| CWQ21_RS00690 (CWQ21_00690) | - | 89292..89774 (+) | 483 | WP_053515027.1 | DUF669 domain-containing protein | - |
| CWQ21_RS00695 (CWQ21_00695) | - | 89792..91345 (+) | 1554 | WP_053515028.1 | hypothetical protein | - |
| CWQ21_RS00700 (CWQ21_00700) | - | 91590..92456 (+) | 867 | WP_053515029.1 | bifunctional DNA primase/polymerase | - |
| CWQ21_RS00705 (CWQ21_00705) | - | 92482..92766 (+) | 285 | WP_053515072.1 | VRR-NUC domain-containing protein | - |
| CWQ21_RS00710 (CWQ21_00710) | - | 92845..93141 (+) | 297 | WP_000763916.1 | nucleotide modification associated domain-containing protein | - |
| CWQ21_RS11270 | - | 93125..93283 (+) | 159 | WP_017646174.1 | hypothetical protein | - |
| CWQ21_RS00715 (CWQ21_00715) | - | 93280..93660 (+) | 381 | WP_053515030.1 | YopX family protein | - |
| CWQ21_RS00720 (CWQ21_00720) | - | 93657..93821 (+) | 165 | WP_000159367.1 | hypothetical protein | - |
| CWQ21_RS00725 (CWQ21_00725) | - | 93818..94087 (+) | 270 | WP_053515031.1 | hypothetical protein | - |
| CWQ21_RS00730 (CWQ21_00730) | - | 94089..94439 (+) | 351 | WP_225971866.1 | HNH endonuclease signature motif containing protein | - |
| CWQ21_RS00735 (CWQ21_00735) | - | 94443..94925 (+) | 483 | WP_053515033.1 | class I SAM-dependent methyltransferase | - |
| CWQ21_RS00740 (CWQ21_00740) | - | 95128..95691 (+) | 564 | WP_053515034.1 | DUF1642 domain-containing protein | - |
| CWQ21_RS00745 (CWQ21_00745) | - | 95678..95995 (+) | 318 | WP_053515035.1 | hypothetical protein | - |
| CWQ21_RS00750 (CWQ21_00750) | - | 96013..96231 (+) | 219 | WP_053515036.1 | hypothetical protein | - |
| CWQ21_RS00760 (CWQ21_00760) | - | 96921..97355 (+) | 435 | WP_000142570.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| CWQ21_RS00770 (CWQ21_00770) | - | 98559..98939 (+) | 381 | WP_000090087.1 | hypothetical protein | - |
| CWQ21_RS00775 (CWQ21_00775) | - | 98929..100203 (+) | 1275 | WP_000634503.1 | PBSX family phage terminase large subunit | - |
| CWQ21_RS00780 (CWQ21_00780) | - | 100203..101528 (+) | 1326 | WP_065367292.1 | phage portal protein | - |
| CWQ21_RS00785 (CWQ21_00785) | - | 101497..102423 (+) | 927 | Protein_106 | minor capsid protein | - |
| CWQ21_RS00790 (CWQ21_00790) | - | 102557..102883 (+) | 327 | WP_053515038.1 | hypothetical protein | - |
| CWQ21_RS00795 (CWQ21_00795) | - | 102997..103566 (+) | 570 | WP_053515039.1 | DUF4355 domain-containing protein | - |
| CWQ21_RS00800 (CWQ21_00800) | - | 103585..104475 (+) | 891 | WP_053515040.1 | hypothetical protein | - |
| CWQ21_RS00805 (CWQ21_00805) | - | 104488..104781 (+) | 294 | WP_053515041.1 | HeH/LEM domain-containing protein | - |
| CWQ21_RS00810 (CWQ21_00810) | - | 104795..105139 (+) | 345 | WP_053515042.1 | hypothetical protein | - |
| CWQ21_RS00815 (CWQ21_00815) | - | 105136..105447 (+) | 312 | WP_053515043.1 | hypothetical protein | - |
| CWQ21_RS00820 (CWQ21_00820) | - | 105444..105839 (+) | 396 | WP_053515044.1 | hypothetical protein | - |
| CWQ21_RS00825 (CWQ21_00825) | - | 105841..106251 (+) | 411 | WP_053515045.1 | DUF5072 family protein | - |
| CWQ21_RS00830 (CWQ21_00830) | - | 106263..106769 (+) | 507 | WP_053515046.1 | phage major tail protein, TP901-1 family | - |
| CWQ21_RS00835 (CWQ21_00835) | - | 106782..107099 (+) | 318 | WP_053515047.1 | hypothetical protein | - |
| CWQ21_RS00840 (CWQ21_00840) | - | 107072..107530 (+) | 459 | WP_053515048.1 | hypothetical protein | - |
| CWQ21_RS00845 (CWQ21_00845) | - | 107523..109721 (+) | 2199 | WP_053515049.1 | hypothetical protein | - |
| CWQ21_RS00850 (CWQ21_00850) | - | 109732..111240 (+) | 1509 | WP_053515074.1 | distal tail protein Dit | - |
| CWQ21_RS00855 (CWQ21_00855) | - | 111231..116198 (+) | 4968 | WP_053515050.1 | glucosaminidase domain-containing protein | - |
| CWQ21_RS00860 (CWQ21_00860) | - | 116199..118202 (+) | 2004 | WP_053515051.1 | DUF859 family phage minor structural protein | - |
| CWQ21_RS00865 (CWQ21_00865) | - | 118214..118606 (+) | 393 | WP_000889196.1 | DUF1366 domain-containing protein | - |
| CWQ21_RS11495 | - | 118629..118757 (+) | 129 | WP_017647842.1 | hypothetical protein | - |
| CWQ21_RS00870 (CWQ21_00870) | - | 118766..119068 (+) | 303 | WP_017647841.1 | hypothetical protein | - |
| CWQ21_RS00875 (CWQ21_00875) | - | 119061..119288 (+) | 228 | WP_000609111.1 | phage holin | - |
| CWQ21_RS00880 (CWQ21_00880) | - | 119414..120748 (+) | 1335 | WP_017647840.1 | GH25 family lysozyme | - |
| CWQ21_RS00885 (CWQ21_00885) | - | 120892..121143 (-) | 252 | WP_000455662.1 | hypothetical protein | - |
| CWQ21_RS11275 | - | 121284..121430 (-) | 147 | WP_001030869.1 | hypothetical protein | - |
| CWQ21_RS00890 (CWQ21_00890) | - | 121580..121789 (+) | 210 | WP_000424774.1 | helix-turn-helix transcriptional regulator | - |
| CWQ21_RS00895 (CWQ21_00895) | prx | 121912..122094 (+) | 183 | WP_017647839.1 | hypothetical protein | Regulator |
| CWQ21_RS00900 (CWQ21_00900) | - | 122307..122999 (+) | 693 | WP_000049272.1 | histidine phosphatase family protein | - |
| CWQ21_RS00905 (CWQ21_00905) | - | 122996..123748 (+) | 753 | WP_000739808.1 | M15 family metallopeptidase | - |
| CWQ21_RS00910 (CWQ21_00910) | - | 123745..124320 (+) | 576 | WP_001231504.1 | glucosaminidase domain-containing protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6933.00 Da Isoelectric Point: 4.2702
>NTDB_id=257358 CWQ21_RS00895 WP_017647839.1 121912..122094(+) (prx) [Streptococcus agalactiae strain SGEHI2015-95]
MLYIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELDK
MLYIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=257358 CWQ21_RS00895 WP_017647839.1 121912..122094(+) (prx) [Streptococcus agalactiae strain SGEHI2015-95]
ATGTTGTATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA
ATGTTGTATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTAGATAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS8232 |
70 |
100 |
0.7 |
| prx | Streptococcus pyogenes MGAS315 |
68.333 |
100 |
0.683 |
| prx | Streptococcus pyogenes MGAS315 |
65 |
100 |
0.65 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
80.488 |
68.333 |
0.55 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
68.333 |
0.5 |